KEGG   Xanthomonas campestris pv. campestris 8004: XC_2992Help
Entry
XC_2992           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY50040
UniProt: A0A0H2X9D1
Position
3587109..3587900
Genome map
AA seq 263 aa AA seqDB search
MIEMPPLQQRNETPTPAADPALSGLARRPSGRRSNAKSDHGSGSADERNQHAGESPLLHA
SGASMLHGNESTSEHFFDAEDSFASSDLSSIRHEQPAPPDPPAHTPAVTTATAAPTRAER
LGALAASIGTGAARGVHTVLGPTANAVKAAARGALPISFDKQYLGAMLGHLVHQATSVGP
TTFARELLGEGLFAALRQLPPEAVVAMQAVSGTLQMALHTLRASRESRNPDAAARGFHNL
SLEQWDALSVDEQQAKEGLNNEA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaaatgccgccgttacaacagcgcaacgagacgccgacacctgcagcggacccg
gcgctgtcgggcctggctcgcaggccttctggacgacgcagcaacgcgaaaagcgaccac
ggatctggcagcgctgatgagagaaaccagcacgccggtgagagcccgctgctgcatgcc
tcgggtgcgtcgatgctgcatggcaacgagagtaccagcgagcacttcttcgatgccgaa
gactccttcgcctcatcagatctgtcgtccattcgccacgaacaacctgcaccacccgat
ccgccagcgcacaccccggcagtcaccacagcaaccgccgcacccacacgcgccgagcgt
ctgggtgcgctggctgcatcgatcggaaccggcgcagcgcgtggcgtgcacaccgtgctt
ggtccgaccgccaatgcggtgaaggccgcggcgcgcggtgcactgccgatcagtttcgac
aagcaatacctgggtgcgatgctggggcacctggtgcaccaggccacttccgtggggccg
accacgttcgcacgcgagttgctgggcgaaggattgtttgccgcccttcgccagctgccg
cccgaagcggtggtcgccatgcaggccgtctccggcacgctgcagatggcgctgcatacg
ctgcgagccagccgcgagagccgcaatcccgacgcggcggcacgaggtttccacaatctc
agtctcgaacagtgggatgcattatccgtcgacgaacagcaagctaaggaaggtctgaac
aatgaggcctga

DBGET integrated database retrieval system