KEGG   Xanthomonas campestris pv. campestris 8004: XC_2995Help
Entry
XC_2995           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY50043
UniProt: A0A0H2X9N7
Position
3591815..3592813
Genome map
AA seq 332 aa AA seqDB search
MKIKVRSSRNLKVPRGSDLPSRIQDVDMPKIHRSNGLHESHSPNGLAGFDQESIVKLHEY
TAPEFLGLSKFSSKKKEVNASTMQNLKLAEDAVLKVKYLLPYGAGNQKTDISYTQGESWA
RRAMLRDNEYNQDPIQNAGRAVAYQAGNCNEHANVGYTLLAASSLNAPLLRVSDADEDHA
YVLIGDPRDPTWGEKDTVVVDAWVTHPTAMTLDQSKGLNPQPTPLFQRPPRAQPDARATA
ALANVSPVSTENVNKYLLEQRGAPEIGQPLLRHIDAYVDTSKFFNERVSVGDPSTRYQSS
ALSSKSFDKIMYCTIEKENYADAAWRGNGFRW
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaggttcgctcttcgagaaatcttaaagtgccaagaggatcagacttgccg
tcccgtatccaggacgttgacatgccaaagatccatcgttccaatggcttacacgaatcc
cattcacccaatggcttggcaggcttcgatcaagagtccattgtcaaacttcatgaatat
acagctcctgagttcctcgggttgagtaagttcagttcgaaaaagaaggaagtaaacgcc
tccactatgcaaaacttgaagctcgctgaagatgcagtgctgaaagtgaagtacttgcta
ccttatggtgcaggtaaccagaaaactgacatcagttacacccaaggagagtcatgggca
aggcgggcgatgctgcgagacaatgagtataaccaggatcccattcagaatgcgggtagg
gctgtagcttaccaagccggaaactgcaacgaacatgcaaatgtgggttatacgctattg
gcggccagctcactcaatgcgcctctacttcgagtaagcgacgcagatgaagaccatgct
tacgtgctgattggtgatccccgtgaccccacgtggggcgagaaagatacggtcgttgtg
gatgcgtgggtgacacatccaacagcaatgacgttagaccaatcaaaaggcttaaatccg
cagcctactcccttgttccaacggcctccacgggctcagccagatgccagagcgaccgct
gcacttgccaacgtaagcccagtatcgactgagaatgtcaataaatatcttcttgagcag
agaggcgcacctgaaattgggcagccgctcctaaggcatattgatgcctatgtggataca
agcaaatttttcaacgaacgcgtttcggttggcgacccaagcaccagatatcaatcctca
gcactatcctcaaagtcgttcgataagattatgtactgcacaatcgagaaagaaaattat
gcagatgctgcctggcgtggcaacgggtttaggtggtag

DBGET integrated database retrieval system