KEGG   Xanthomonas campestris pv. campestris 8004: XC_2998Help
Entry
XC_2998           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PI3_PI4_kinase
Motif
Other DBs
NCBI-ProteinID: AAY50046
UniProt: A0A0H2X9U2
Position
3593715..3595070
Genome map
AA seq 451 aa AA seqDB search
MQQPPPTRRQTLGALLAEELSQEEAARLGKQARRDALTQLLQAALPNGGRTMRRLKARAA
RKQPVSVADRWSVIRNGAPKPMQGERRESFEALVRSDLLAIARAGEIDPLVAVKKMAEAL
EEAILGQGILMSDRQLLDEVLDSLSIDRLYTRLNLKMTDDTMPAFTNAQVLQAPRELGEG
RSNTVYEVEIRNADGAAMSAVFKPLIHEPPSPDKWSVVARLTGISREEPQTAMRNLATVA
YARRLGFHVVADTRVALMNLGQDPFEPALGLIMERAQGKPAEEVDASTLVQANVCAEVMK
LQLLDHLTGEADRHDKNYFIHVKPDGRAKVMGIDNDNCFGAELTAPDGAQPDLEDPQRRA
FHGTALPPVVDTDMERAILALTEEDIRSMLKDKLNDSEIAAAIQRYQGVRQHLLALRNSG
LVIEPHEWGRADVQQRLTPTNSYLGRELEFA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
ttgcagcagcccccgccgactcgtcgccagacgctgggtgcattgttagccgaggagcta
agccaggaagaagccgccaggctgggcaagcaagcccggcgcgacgcactgacgcaacta
ctgcaggccgccttgcccaacggggggcgaaccatgaggcggctgaaggcgcgggcggcc
agaaagcaacctgtcagcgtggccgatcgatggagcgtgatccgcaatggagctcccaaa
ccgatgcaaggggagcgaagggagtcgttcgaggcactggtgcgcagtgatctgctggcg
atcgcacgcgccggcgagatcgatccattggttgcagtcaaaaaaatggccgaagccctg
gaagaggcaattctgggccagggcattttgatgagcgatcggcaactgctggatgaagta
ttggacagcctgtcgattgatcgcctgtacacgcggctgaatctgaagatgacggacgac
accatgcctgccttcaccaacgcgcaggtgctgcaggcgccgagggagctaggagaaggc
cgctccaacacggtgtacgaggtcgagatccggaacgcggatggagctgcgatgagcgcg
gttttcaagccgcttatccacgagccaccctctccggataagtggagtgtagttgccaga
ttgacgggcatttccagggaagaaccgcaaacagcgatgcgcaatctcgcaaccgtggcc
tatgcaaggaggctcgggttccacgtggttgccgacacgcgcgtggcgctgatgaatttg
ggacaagatccctttgagccagctctgggtctgatcatggaacgcgcccaaggaaaacca
gccgaagaggtcgatgcgtccaccctggtccaggcgaacgtgtgcgccgaagtgatgaag
ctgcagctgctcgaccatctgacgggcgaagctgatcgccacgacaaaaactatttcatt
cacgtcaagccggatggtcgagccaaggttatgggcatcgacaacgacaactgttttggt
gcggaacttaccgccccagacggtgcccagccggacctggaagacccgcaacgcagggcg
tttcatgggactgcgcttcccccggtggtagataccgacatggagcgcgccatccttgca
ctcacggaagaagacattcggtcgatgctgaaagacaagctcaacgattccgagatcgcc
gccgccatccagcgttatcaaggcgtccggcagcatctccttgccctgcggaattccggc
ctggttatcgagccgcacgaatggggccgggcggatgtacaacaacgcctgaccccgaca
aacagctatttgggccgcgaactcgaatttgcttag

DBGET integrated database retrieval system