KEGG   Xanthomonas campestris pv. campestris 8004: XC_2999Help
Entry
XC_2999           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY50047
UniProt: A0A0H2XBA8
Position
3595579..3596112
Genome map
AA seq 177 aa AA seqDB search
MGAAGKSAGQPEMAARLLASDLKIAAYAAARDTIQATFRMVGMRGPTNGGISDPRITSAG
RFYGMANVLANLASNELASPDFAAAEQRWAGLNSPFTKGEATSVIFRQSAVNTALNVGLE
TLDCINVTQHEADEAGTKQIWEPAWKGKRGDYERVMITRSHARPPSTPISRSVPPST
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgcggccggcaagtcagcgggccaaccggagatggcggcgaggctgctggccagc
gatctgaagatcgccgcttatgccgcagcccgcgacaccatccaggcgacatttcgcatg
gtgggaatgcgtggccccaccaatggcggcatcagcgacccgcgcatcaccagcgccggc
aggttctatggcatggccaacgtgctggccaacctggcatcgaacgagctggcatcgccg
gactttgcagcggccgagcagcgctgggccgggctgaactcgcctttcaccaaaggcgag
gcgaccagcgtcatctttcgtcaatcggcagtgaacaccgccttgaatgtcggcctggaa
acgttggactgtatcaacgtcacgcagcacgaagccgacgaagccgggaccaagcaaatc
tgggaacccgcgtggaagggcaagcgcggggattacgagcgggtgatgatcactcggtcg
cacgcacggccgccatcaactccaatatcgcgctcggtacctccatcaacatga

DBGET integrated database retrieval system