KEGG   Xanthomonas campestris pv. campestris 8004: XC_3000Help
Entry
XC_3000           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAY50048
UniProt: A0A0H2X9R7
Position
3596109..3596270
Genome map
AA seq 53 aa AA seqDB search
MIGAWVGLSPARSGLLANTVSGVVAGMQYKTIGATWQAEAAVRGAEASRAQSE
NT seq 162 nt NT seq  +upstreamnt  +downstreamnt
atgattggcgcctgggtcgggttgtcgcctgcacgcagcggattgctcgccaacacggtg
tccggcgtggtcgccggcatgcaatacaagaccatcggtgccacctggcaggccgaggcc
gcggttcgcggcgccgaagcatctcgcgcgcagtctgagtaa

DBGET integrated database retrieval system