KEGG   Xanthomonas campestris pv. campestris 8004: XC_3005Help
Entry
XC_3005           CDS       T00247                                 

Definition
(GenBank) HrpB7 protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HrpB7 DHR10 TPR_MLP1_2 DUF724 YscO Tropomyosin Fez1 Filament CC2-LZ MCU zf-TRAF ATG16
Motif
Other DBs
NCBI-ProteinID: AAY50053
UniProt: A0A0H2X9S1
Position
complement(3600563..3601072)
Genome map
AA seq 169 aa AA seqDB search
MRERVSTWRTLQQLKTRRYQRMQDHLSDCRRALEQCDGERASCSQQADACTTRLAAFDAA
LADTAGAGEPIGIEAILQHQRFRAVLEERCGAAEQALVAATQALQRAHDEVATVQQTVSR
LEAQAQVYAEKAARARRAWQAQREAAEEEDAIEALIGLRLHRAARGVGP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagcgtgtcagcacctggaggacgttgcagcagctgaagacgcgccgttaccag
cggatgcaggaccacctgagcgactgcaggcgtgcgctggagcagtgcgatggcgagcgc
gccagttgcagtcagcaggccgacgcctgcaccacgcgcctggccgcgttcgatgccgcg
ctggccgacacggccggcgcgggtgagccgatcggcatcgaggcgatcctgcagcaccag
cgcttccgcgcagtgctggaagagcgctgcggcgccgcagagcaggcgctggtcgcagcg
acgcaggcgttgcagcgcgcgcacgatgaggtggcgactgtgcaacagacagtgagcagg
ctggaggcgcaggcgcaggtgtatgcggaaaaagccgcccgcgcgcgccgtgcctggcaa
gcccaacgcgaagcggccgaggaggaagacgcgatcgaagccttgatcgggctgcgtctg
catcgtgccgcccgcggagtggggccatga

DBGET integrated database retrieval system