KEGG   Xanthomonas campestris pv. campestris 8004: XC_3006Help
Entry
XC_3006           CDS       T00247                                 

Definition
(GenBank) HrpB6 protein
  KO
K03224  ATP synthase in type III secretion protein N [EC:3.6.3.50]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb03070  Bacterial secretion system
Module
xcb_M00332  Type III secretion system
xcb_M00660  Xanthomonas spp. pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XC_3006
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xcb02044]
    XC_3006
Secretion system [BR:xcb02044]
 Type III secretion system
  Type III secretion core apparatus [MD:M00332]
   XC_3006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab T3SS_ATPase_C ATP-synt_ab_N ABC_tran AAA_22 DUF87 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AAY50054
UniProt: A0A0H2XBB9
Position
complement(3601065..3602393)
Genome map
AA seq 442 aa AA seqDB search
MLAEMPLLQTTLERELAALAFGRRYGKVVEVIGTMLKVAGVQVSLGEVCELRQRDGTLLQ
RAEVVGFSRTLALLAPFGELVGLSRQTRVIGLGRPLAVPVGSALLGRVLDGLGEPADGQG
PLAGDDWVQIQAQAPDPMRRRLIEQPLPTGVRIVDGLMTLGEGQRMGIFAAAGVGKSTLI
GMFARGTQCDVNVIVLIGERGREVREFIEMILGPDGLARSVVVCATSDRSSIERAKAAYV
GTAIAEYFRDRGMRVLLMMDSLTRFARAQREIGLAAGEPPTRRGFPPSVFAELPRLLERA
GMGETGSITAFYTVLAEDDTGSDPIAEEVRGILDGHLILSREIAARNQYPAIDVLGSLSR
VMSQIVSAEQRQYAGQLRRLLAKHNEVETLLQVGEYRHGSDAVADEAIARIDAIRDFLSQ
PTDQLSDYDTILEQLAGVIDDA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgagatgccgctgctgcagacgacgctcgagcgcgaactggccgcgctcgcg
ttcggccgccgctacggcaaggtggtcgaagtgatcggcaccatgctcaaggtggctggt
gtgcaggtcagcctgggcgaggtgtgcgagttgcgccagcgcgacggcacgctgttgcag
cgtgccgaggtggtgggcttcagccgcactctcgccttgctggcgccgtttggcgagctg
gtggggttgtcgcgccagacgcgcgtgatcggattagggcgtcccttggcggtgccggtc
ggatcggcgctgctggggcgcgttctcgatggactgggcgagccggcggacggccagggg
ccgcttgcaggcgacgattgggtgcagatccaggcgcaggcgccggatccgatgcgccgg
cgcctgatcgaacagccgctaccgaccggtgtgcgcatcgtcgatggcctgatgacgctg
ggcgaaggccagcgcatgggcattttcgccgcagctggcgtcggcaagagcaccttgatc
gggatgttcgcgcggggcacgcagtgcgatgtcaacgtgatcgtgctgatcggcgagcgc
gggcgcgaagtgcgtgaattcatcgagatgattcttggcccggacggtctggcacgcagc
gtggtggtgtgcgcgacctccgatcgctcctccatcgagcgcgccaaggcggcttatgtc
ggcaccgccatcgccgaatattttcgcgatcggggcatgcgggttctgctgatgatggac
tcgctgacgcgctttgcccgcgcacaacgcgagatcggtctggctgccggcgagccgccc
acgcgtcgcggcttcccgccgtcggtgttcgccgagttgccgcgcctgctcgaacgtgcc
ggcatgggcgagacgggctcgatcaccgcgttctacacggtgctggccgaagacgacacc
ggcagcgatccgatcgccgaagaagtgcgcggcatcctggatggccatctgattctgtcg
cgcgagatcgccgccaggaaccagtacccggcgatcgatgtgctgggaagcctgagccgg
gtgatgagccagatcgtctctgccgaacaacgccagtacgccggccagctgcggcgtttg
ctggccaagcacaacgaggtggagaccttgctgcaggtcggcgaataccgccacggcagc
gatgcggtcgccgacgaagcgatcgccaggatcgatgcgatacgcgacttcctgagccag
cccaccgatcagctcagcgactatgacaccatcctggaacagcttgccggcgtgatcgac
gatgcgtga

DBGET integrated database retrieval system