KEGG   Xanthomonas campestris pv. campestris 8004: XC_3011Help
Entry
XC_3011           CDS       T00247                                 

Definition
(GenBank) HrpB1 protein
  KO
K18373  type III secretion protein HrpB1
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Module
xcb_M00660  Xanthomonas spp. pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xcb02044]
    XC_3011
Secretion system [BR:xcb02044]
 Type III secretion system
  Type III secretion related proteins
   XC_3011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HrpB1_HrpK
Motif
Other DBs
NCBI-ProteinID: AAY50059
UniProt: A0A0H2XBC3
Position
complement(3604898..3605353)
Genome map
AA seq 151 aa AA seqDB search
MEKIECPGSVVSGLIELITVGLTHEKIEEAAAVLAAVRVLRPELKALDTFDAWIAIKRGS
YLEGARLLRELEADAGSEPLCKALYACCLFAVGDPSWHGIAEGLIEEDADADAVGLVKAL
SGRYTPAPAPLEAAAESAAPMDVPNAQYLRA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagattgaatgtcccggttcggtcgtgagcgggctgatcgaactgatcacggtc
gggctgacccacgaaaaaatcgaagaggccgcagcggtgctggccgccgtgcgagtactg
cggccagagttgaaggcgctggataccttcgatgcctggattgcgatcaagcgcggcagt
tatctggagggcgcgcgcctgctgcgtgagctggaggccgatgcgggctccgagccgttg
tgcaaggccttgtacgcgtgttgcctgtttgcggtgggcgacccgtcctggcatggcatt
gcagagggcctgatcgaagaggacgccgatgccgacgccgttggactggtcaaggcgctg
tcaggacgctacaccccggcacccgcgccgctggaagcggcggccgaatccgccgcgccg
atggacgttcccaacgcccagtatctgcgcgcctga

DBGET integrated database retrieval system