KEGG   Xanthomonas campestris pv. campestris 8004: XC_3022Help
Entry
XC_3022           CDS       T00247                                 

Definition
(GenBank) HpaB protein
  KO
K18380  type III secretion control protein HpaB
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Module
xcb_M00660  Xanthomonas spp. pathogenicity signature, T3SS and effectors
Brite
Secretion system [BR:xcb02044]
 Type III secretion system
  Type III secretion related proteins
   XC_3022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CesT
Motif
Other DBs
NCBI-ProteinID: AAY50070
UniProt: A0A0H2X9I5
Position
3613571..3614053
Genome map
AA seq 160 aa AA seqDB search
MSSTRFEAIVQQMCEALDLPDVQAVLSSRVLWVEGFEVYLHMPAAQTDDEAQQVPEEEAL
YLRISYGLAPAGRTLTVFRLLLEANLSVYAQDQAQLGLNDAGVIVLVVRVPLDDDVDGAW
ICDLLAHYAEHGRYWNNNIFIAHDEMFEGIATGNYLWLRA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcacccgattcgaagcgatcgttcagcagatgtgcgaagcattggacctgccg
gatgtgcaggcggtgctcagcagtcgtgtgctctgggtggaagggtttgaagtctatctg
cacatgcctgcagcccagaccgacgatgaagcacagcaagttccggaagaagaagcgctg
tacctacgcatctcctatggcctagcacctgcaggacgcaccttgacggtcttccggctg
ttgctggaagcgaatttgtcggtgtacgcacaggaccaggcgcaactcggattgaacgat
gccggcgtgatcgtgctggtcgtacgtgttccactggacgacgacgtcgacggcgcatgg
atctgcgatctgctcgcccactatgccgagcatggccgttactggaacaacaacatcttc
attgcacacgacgaaatgttcgaaggaatcgcaaccggaaattatctgtggctacgcgcg
tga

DBGET integrated database retrieval system