KEGG   Xanthomonas campestris pv. campestris 8004: XC_3023Help
Entry
XC_3023           CDS       T00247                                 

Definition
(GenBank) HrpW protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectate_lyase Beta_helix
Motif
Other DBs
NCBI-ProteinID: AAY50071
UniProt: A0A0H2X9W2
Position
3614340..3615314
Genome map
AA seq 324 aa AA seqDB search
MQRMLRDMLQPQDQPFSDGQPPTNPNPTPPMPPSRPPCSTNPGGQHGSGTGDGSGGNGGN
HNRGNGGTCGTGADHRASPTNPGQAVRPCPDGPQAPLPPGKVVTAPPGLQNKTIVVHKGE
VFDGKGQTYIGGPGLGDGSQNEHQQPLFVVEDGGSLCNVNMKGGGDGVHFMGSGKMVNCV
NDDVSEDAVTIDGQGNREHDARIAGCRPEVSGRPKVDIINCTFKNAADKVVQDNGAADVV
MSGCTVNGAGKVFRTNGGHADIDTHLQVENCDFQQVKEAVFRTDAPGATVKLANLKTDAP
DEVIAPSAFQATGATRIGHQPYSG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcatgctcagggacatgctgcagccacaggatcagccattcagcgacggtcag
ccaccgaccaacccgaatccgacaccaccgatgccgccctcgcgcccgccctgttccacc
aaccccggcggacaacacggtagcggtactggcgatggcagcggcggcaatggcggcaac
cacaacagaggcaacggcggcacctgcggaacgggagccgatcaccgcgcatcgcccacc
aacccgggtcaggcggtgaggccctgccccgatggtccgcaggccccacttcctcccggc
aaggtcgtcaccgcgccacccggcctccagaacaagaccatcgtggtgcataagggcgag
gtattcgacggcaagggtcagacctacatcggtggccctggtctgggcgatggctcccag
aacgaacaccagcagccgctgttcgtcgtcgaggacggcggtagcctgtgcaacgtcaac
atgaagggcggcggcgacggcgtgcatttcatgggcagcggcaagatggtcaactgcgtc
aacgacgatgtcagcgaggatgcggtcaccatcgatggccagggcaaccgcgagcatgat
gcgcgcattgccggttgtcgcccggaggtcagcggccggccgaaggtcgacatcatcaat
tgcacgttcaagaatgccgcagacaaggtcgtgcaggacaatggtgctgccgacgtggtg
atgtcgggttgcaccgtcaacggcgccggcaaggtctttcgtaccaacggtggacacgct
gatatcgacacgcatcttcaggtcgaaaattgcgatttccaacaggtcaaggaagcggtg
ttccgtaccgatgcgccgggcgcgacggtgaagctggcaaacctgaagaccgatgcgccc
gacgaggtgattgcccccagcgctttccaggccaccggagcgacccgaatcgggcatcag
ccctacagcggctga

DBGET integrated database retrieval system