KEGG   Xanthomonas campestris pv. campestris 8004: XC_3031Help
Entry
XC_3031           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_oxidored FAD_binding_3 DAO HI0933_like Pyr_redox Pyr_redox_2 GIDA
Motif
Other DBs
NCBI-ProteinID: AAY50079
UniProt: A0A0H2XBE1
Position
complement(3625251..3626705)
Genome map
AA seq 484 aa AA seqDB search
MSALPIAVLGGSVAGLMTALSIARTGAQVELVERDALTAQRSDPASGNDSVEYWWRKGAP
QARHTHALAALGRRTLRERAPDVWQALIDAGAIEMPFGAQLQGAIAVPRCADPELFGLSV
RRSLVEDVLRPIVLAERTIRVRDQTSVTGLLMRSADIPVVEGVTTSQGDLRAALTIDALG
RGSSFAKWLRAAGVHPPEETVEGCGLVYFTRWYRIVQRPSVRLDAGFSAGGYALSSGCIV
CPADNGYASITLMVTHADKALQAFTEPAAFTAAARSHVGIAPWLAPGAMDALSGVLRWPL
CENRYRPLLVEGRPRVLGAIAVGDALCITNPTYTRGMSLAMRYAFAIADLLQRDGLDDAH
RIAVEADALAQDLVRPWHDDGAAQDRVRTALWAGAPAPPTQADAITLQQIAMASRHDEVV
WQALARRSGMLDAPEAIFRQAEVLERVNSILERVQPSPPAAPSRGDLLRVLEQHRSVDFA
HPLA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgctacccatcgcggtacttggcggcagcgtggccggcctgatgacggcgctc
tcgattgcgcgtaccggagcgcaagttgagcttgtcgagcgggatgcgttgactgcgcag
cggtccgacccggcgagcgggaacgacagcgtcgaatattggtggcgaaagggagcgccg
caggcgcggcatacccacgcactcgctgcactcgggcggcgcacgttacgagaacgcgca
ccagatgtgtggcaagcattgatcgatgcgggcgccatcgagatgcctttcggagcacaa
ctgcaaggtgccattgcggtgccacgttgcgcggacccggagttgtttggattgtcggtg
cggcgttcgttggtggaggacgtacttaggccgatcgtgttggccgagcgcactattcgt
gtgcgtgaccagaccagcgtgaccggtctgctaatgcgttctgccgacatcccggtcgtg
gagggcgtgaccacctcgcaaggcgatctgcgtgcggcgttgaccatcgatgcgctgggt
cgcgggtcgtcgttcgcaaagtggctgcgggcagccggtgtgcatccacccgaggaaacg
gtggaaggctgcggtctggtgtatttcacccgctggtatcgcattgtgcagcggccgagc
gtgcggctcgatgcgggcttttcggcaggtggctacgcgctatcgagtggttgcatcgtc
tgccctgccgacaacggctacgcgtcgatcaccctgatggtgactcacgcggacaaggcc
ttgcaggcgttcaccgagccggccgcgttcaccgcggcggcgcggtcgcatgtaggcatc
gcgccatggcttgcgcccggcgccatggatgcgctgtcgggtgtgctgcgctggccgctc
tgcgaaaaccgctatcgccccctgcttgttgaaggacgcccgcgcgtgttgggtgcgatt
gcggtcggcgatgcgctgtgcatcaccaacccgacctatacgcgcggcatgtcgctggcg
atgcggtatgcgtttgccatcgccgatctgctgcagcgcgatggtctggatgatgcgcat
cggattgcggtggaggcagacgccctggcgcaggatctggtgcgtccgtggcatgacgat
ggcgcggcgcaggaccgcgtgcgcacagcgctctgggcgggcgcgccggctccacccacg
caggcagatgcgatcaccttgcagcagatcgcgatggcatcgcgccacgatgaggttgtt
tggcaagcgctggcgcggcgttcgggaatgctggatgcgcctgaggccatctttcgccaa
gccgaggtgttggagcgtgtgaattccatccttgagcgtgtgcagccgtcgccaccggct
gctccatccagaggcgatcttctgcgtgttctcgaacaacaccgcagcgttgattttgcg
catccacttgcgtga

DBGET integrated database retrieval system