KEGG   Xanthomonas campestris pv. campestris 8004: XC_3034Help
Entry
XC_3034           CDS       T00247                                 

Definition
(GenBank) IS1595 transposase
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_IS1595 Zn_Tnp_IS1595 RNaseH_like Prim_Zn_Ribbon Zn_ribbon_recom
Motif
Other DBs
NCBI-ProteinID: AAY50082
UniProt: A0A0H2X9W8
Position
complement(3628781..3629704)
Genome map
AA seq 307 aa AA seqDB search
MPEFFASYGTEAKCYRALYKWRWPQGFRCPVCAGRVRSRFKRGAAIYYQCSACRHQTSLM
AGTMFEGTKLPLRTWMLALHLLTSTKTNMAALELMRHLGVNYKSAWRMKHKIMQVMAERE
STRKLAGFVQIDDAYLGGERNGGKAGRGSENKQSFLIAVQTDDTFTAPRFVVIEPVRSFD
NPSLQDWIARRLAPGCEVYTDGLACFRRLEDAGHAHTTLDTSGGRAATEATGARWVNVVL
GNLKRAISGVYHAIAQGKYAKRYLAEAAYRFNRRFRLREMLPRLATAMMQSTPCPEPVLR
AASNFHG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttcttcgcgtcctacggcaccgaggccaagtgttatcgcgcgctctacaag
tggcgttggccgcagggctttcgttgccctgtttgtgccgggcgcgtgcgctcgcgtttc
aagcggggtgctgcgatctactaccaatgcagcgcgtgccgacatcagaccagtctgatg
gcaggcacgatgttcgaaggcaccaaactgccgcttcgcacctggatgctggcgttgcac
ctgctgacctcgaccaaaaccaacatggccgcgctggagctgatgcgccatctgggggtg
aactacaagagcgcctggcggatgaaacacaagatcatgcaggtcatggccgagcgcgaa
tccacgcggaaactggcgggtttcgtgcagatcgacgatgcctacctgggcggtgagcgc
aacggtggcaaggctggacgcggatcggaaaacaaacaatcgttcctgatcgcggtgcag
accgatgacaccttcaccgcaccgcgctttgtggtgatcgagccggtgcgcagcttcgat
aacccctcgctgcaagactggattgcccgtcgcctggcgcccgggtgcgaggtctacacc
gatgggttggcctgcttccgtcggctggaggatgccggtcacgcgcacaccacactcgat
accagtggcgggcgtgccgcgaccgaagcaaccggtgcgcgttgggtcaacgtggtgctt
ggcaatctcaaacgcgccatcagcggcgtgtatcacgccatcgcgcaaggcaaatacgca
aagcgttacctggccgaagccgcctaccgtttcaatcgtcgattccgcttgcgcgagatg
ctgccacgacttgccacggccatgatgcaatccacaccatgtccagaaccggtgttgcgt
gcagcgagcaatttccatggctga

DBGET integrated database retrieval system