KEGG   Xanthomonas campestris pv. campestris 8004: XC_3038Help
Entry
XC_3038           CDS       T00247                                 

Definition
(GenBank) heat shock protein 15 homolog
  KO
K04762  ribosome-associated heat shock protein Hsp15
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:xcb03110]
    XC_3038
Chaperones and folding catalysts [BR:xcb03110]
 Heat shock proteins
  HSP15
   XC_3038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S4
Motif
Other DBs
NCBI-ProteinID: AAY50086
UniProt: A0A0H2X9T9
Position
complement(3637299..3637706)
Genome map
AA seq 135 aa AA seqDB search
MTLQMESAVTVRLDVWLWAARFFKTRSLAKHAVDTGKVGVAGQRPKPSRALRTGEQLRID
RGGEIFEITVAALSEVRGPAPVAQALYTETEASREARAQWRLQRAAERTGYRPPDGKPDK
RARRLITALGDIDAL
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgactctacagatggaatcagcggtcacggtcaggctggatgtctggctctgggcggcg
cgctttttcaagacgcgcagccttgccaagcatgcggtggataccggcaaggtgggtgtg
gccggtcagcgtcctaaaccgtcgcgcgcactgcgcaccggcgagcaactgcggatcgac
cgcggcggcgaaattttcgagatcaccgtggcggccctgagcgaggtgcgcggcccggcg
ccggtggcgcaggcgctctacacggaaaccgaggcatcgcgcgaagcgcgcgcgcagtgg
cggctgcaacgtgccgccgagcgcaccgggtatcgcccgcccgatggcaagccagataaa
cgcgcacgtcgcttgatcacggcgctgggtgatatcgacgcgttgtag

DBGET integrated database retrieval system