KEGG   Xanthomonas campestris pv. campestris 8004: XC_3039Help
Entry
XC_3039           CDS       T00247                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MatE Polysacc_synt_C
Motif
Other DBs
NCBI-ProteinID: AAY50087
UniProt: A0A0H2XBE6
Position
3638252..3639727
Genome map
AA seq 491 aa AA seqDB search
MPKSAVLTEGPIGKNLLLFALPILAGNIAQSLNGSINAIWIGRYLGEAALTAAANANSIM
FFLIGSVFGIGMAATILIGQAMGARDIAQARKVMGTSATFFGGLSALIAVAGWWLAPHLL
AAMGTPPASLALAEDYLRVIFVAMPTIYLFAFLSAALRGTGDARTPFRFLLLSVVLDIVF
NPLLIFGVGPFPQLGIAGAAWATVLAQSVALAGLLLYLRSRGHVLWLGRRDLALFRIDPA
ILRALVGKGVPMGLQMVLISLAMIAMLTLVNGFGTDTAAAYGAALQLWNYVQMPAMALGA
ACSTMAAQNVGAGLWARVDATARTGVAANFLMTGLLIAPLILFDRWTLALFLPSDSPALE
IARHLNHISIWSFLLFGVTFVVSGVVRATGAVIPPLLILAFALWGVRVPLANLLLPHLGA
DAVWWSFPISSACSMLLSLAYYRWGGWRKARMLATPAHPSELASAAEVPAHPAAPIADPA
PLTEPPAAQPR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaatccgccgtattgaccgagggaccgatcggcaagaacctgctgctgttcgcg
ttgccgatcctggcaggcaacatcgcccagtcgctcaacggctcgatcaatgcgatctgg
atcggccgctatctcggcgaagccgcgctcactgcggcggccaacgccaacagcatcatg
ttctttctgatcggctcggtattcggcatcggcatggccgccaccattctgataggccaa
gccatgggcgcgcgcgacatcgcccaggcacgcaaggtcatgggcaccagcgccacgttc
tttggcgggttgtcggcactgatcgccgtcgccggctggtggctggcgccacacctgctt
gccgcgatgggcacgccaccggcctcgctggcgctggccgaggattacctgcgggtgatc
ttcgtggccatgcccaccatctacctgttcgcgttcctgtcggcggccctgcgcggcacc
ggcgatgcacgcacgccgtttcgcttcctgctgctctcggtggtgctggacatcgtgttc
aacccgctgctgatcttcggcgttggcccctttccgcagctaggcatcgccggcgcggcc
tgggccacggtgctggcgcagtcggtggcgctggcggggctgctgctgtatctgcgcagc
cgtggccacgtgctgtggctgggacggcgcgacctggcgctgttccgcatcgatcccgcc
atcctgcgtgcgctggtgggcaaaggcgtgccgatgggattgcagatggtgctgatctcg
ctggccatgatcgcgatgctgacgctggtcaacggcttcggcaccgataccgctgccgcc
tatggcgcagccctgcaactgtggaactacgtgcagatgccggcgatggcgctcggcgcg
gcctgctcgacgatggccgcgcagaatgtcggcgccggcctgtgggcgcgcgtggatgcc
accgcacgcaccggtgtggccgccaatttcctgatgaccggcctgctcatcgcaccgctg
atcctgttcgaccgctggacgctggcattgttcctgcccagcgacagcccggcgctggag
atcgcgcgccacctcaatcacatttcgatctggtcgttcctgctgttcggcgtgaccttc
gtggtttccggcgtagtgcgtgccaccggcgcggtgatcccgccactgctgatcctggcg
ttcgcgctgtggggcgtccgcgtgccgctggccaacctgctgctgccgcacctgggcgcg
gacgcggtgtggtggagctttccgatcagctcggcctgctcgatgctgctgtcgctggcg
tactaccgctggggtggctggcgcaaggcccgcatgctggcaacaccggcgcatccctcc
gaactggcatcggcagcggaagtgccggcccacccggccgccccgattgccgaccccgcc
ccactgaccgagccgcctgcagcgcagccgcgctga

DBGET integrated database retrieval system