KEGG   Xanthomonas campestris pv. campestris 8004: XC_3041Help
Entry
XC_3041           CDS       T00247                                 

Definition
(GenBank) tRNA (guanine-N1-)-methyltransferase
  KO
K00554  tRNA (guanine37-N1)-methyltransferase [EC:2.1.1.228]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:xcb03016]
    XC_3041
Enzymes [BR:xcb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.228  tRNA (guanine37-N1)-methyltransferase
     XC_3041
Transfer RNA biogenesis [BR:xcb03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    XC_3041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_m1G_MT
Motif
Other DBs
NCBI-ProteinID: AAY50089
UniProt: Q4US84
Position
complement(3641382..3642140)
Genome map
AA seq 252 aa AA seqDB search
MRIDVISLFPEFIAQCAAFGVVGRAQERGLLELKGWNPRDHAQGNYRRVDDRPFGGGPGM
VMLIEPLRACLEVAQAADARPAPVIYLSPQGRPLTQPLARELAQLPRMVLLCGRYEGVDE
RFLDQAVDMEISIGDYVLSGGELGAAVLVDVVTRLQDGVLNDAESAAQDSFEGPQGLLDC
PHYSHPSSHAWGDVPEVLRSGNHGAIARWRRQQSLGRTWLRRPELLDEATLDKQDRRLLE
EFRRELAPGDEK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcgacgtcatcagcctgtttcccgagttcatcgcgcaatgcgcggcgttcggc
gtggtcgggcgggcgcaggaacgtgggttgctggaattgaagggttggaatccgcgcgac
catgcgcagggcaattaccgccgggtggacgaccgtcccttcggtggcggccctggcatg
gtgatgttgatcgagccgttgcgggcctgtctggaagtggcgcaagccgccgatgcgcgg
ccggcaccggtgatctacctcagcccgcaagggcgtccgctgacccagccactggcgcgc
gagctggcccagttgccacggatggtgctgctgtgcgggcgctatgaaggtgtcgacgag
cgttttctcgaccaggccgtggacatggaaatctccatcggcgactacgtattgtccggt
ggcgagctcggtgcggcggtactggtggatgtggtgacccggttgcaggacggcgtgttg
aacgatgccgaatccgcagcccaggacagtttcgaaggcccgcaggggctgctggactgc
ccgcactacagccatccatccagccatgcctggggtgatgtgccggaggtgctgcggtcg
ggcaaccacggcgccattgcgcgctggcggcggcagcaatcgttgggccggacctggctg
cgtcggccggaattgctcgacgaggccacgctggataagcaggatcgacgtctgctggaa
gagttccgtcgcgaacttgccccgggcgacgagaaataa

DBGET integrated database retrieval system