KEGG   Xanthomonas campestris pv. campestris 8004: XC_3042Help
Entry
XC_3042           CDS       T00247                                 

Definition
(GenBank) 16S rRNA processing protein RimM
  KO
K02860  16S rRNA processing protein RimM
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:xcb03009]
    XC_3042
Ribosome biogenesis [BR:xcb03009]
 Prokaryotic Type
  ribosomal protein modification factors
   XC_3042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimM PRC
Motif
Other DBs
NCBI-ProteinID: AAY50090
UniProt: Q4US83
Position
complement(3642205..3642717)
Genome map
AA seq 170 aa AA seqDB search
MKPTERRILLGRIVGAFGVKGELKLESWTEPRSAIFRYQPWIVRTPSGQESVLSGVRGRD
QGKNLIAVFPDITDRDTVEAMHGTEIYVARSALPPPKPDEYYWVDLEGLQVETVEGVKLG
TVSHLFSTGSNDVVVVRGDRERMIPFVLPEYVKSVDFEANLIVVDWDPDF
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgaccgagcgccgcatcctgttaggcaggattgtcggcgcttttggtgtcaag
ggcgagctcaagctcgaatcctggaccgagccgcgcagtgcgatcttccgctatcagccg
tggatcgtgcgcacgccgtcgggtcaggagtcggtgctcagtggagtccgtgggcgcgat
cagggcaagaacctgattgcggtgttccccgacatcaccgaccgcgacaccgtcgaagcc
atgcacgggaccgagatctatgtcgcccgcagtgcgctgccgccgcccaagcccgatgag
tattactgggtcgatctggaaggcttgcaggtggaaaccgtcgagggcgtcaagctcggc
acggtctcgcatctgttctccaccgggtccaacgatgtggtggtggtgcgcggcgatcgc
gagcggatgatcccgtttgtgttgccggagtacgtcaagtcggtggatttcgaggccaat
ctgatcgtggtcgactgggatccggatttctga

DBGET integrated database retrieval system