KEGG   Xanthomonas campestris pv. campestris 8004: XC_3048Help
Entry
XC_3048           CDS       T00247                                 

Definition
(GenBank) signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb02024  Quorum sensing
xcb03060  Protein export
xcb03070  Bacterial secretion system
Module
xcb_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    XC_3048
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    XC_3048
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    XC_3048
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xcb02044]
    XC_3048
Enzymes [BR:xcb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     XC_3048
Secretion system [BR:xcb02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   XC_3048
  Eukaryotic Sec-SRP protein
   XC_3048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRP54 SRP_SPB SRP54_N Zeta_toxin CbiA cobW AAA_22 AAA_33 AAA_31 AAA_30 Helicase_RecD ATP_bind_1 AAA_16 APS_kinase KTI12 ATPase HrpJ ABC_tran DnaB_C ResIII AAA AAA_14 AAA_28 AAA_19 Thymidylate_kin AAA_5 MMR_HSR1 DUF2075 Rad17 AAA_18 NACHT TsaE
Motif
Other DBs
NCBI-ProteinID: AAY50096
UniProt: A0A0H2XBF2
Position
complement(3647450..3648826)
Genome map
AA seq 458 aa AA seqDB search
MFESLTQRLSGTMERLRGRGRLTEENIREATREVRIALLEADVALPVVQALIERIKVRAV
GQEVLKSLTPGQALIKIVRDELTAVMGAAAADLNLNVPAPAIILMAGLQGAGKTTTVGKL
AKHMKEKRKKKVMVVSADVYRPAAIEQLKTLAEQVGVLFFPSDASQKPVDIVRAAISDAR
KSFADVLLVDTAGRLAIDAAMMDEIKALHAAVNPTETLFVVDAMTGQDAANTAKAFGEAL
PLTGVVLTKTDGDARGGAALSVRYITGKPIKFVGTGEKTDGLDVFHPDRVASRILDMGDV
LSLVEQVEHSVDQEKAAKLAAKVAKGKKFDLNDMKEQLEQMQNMGGIHGLMDKLPGMGQI
PDNVKQQVTGKEVPRMIAIINSMTKKERRNPALLNGSRRARIARGSGMQPADVNKLMKQY
QQMEKMMGKLAGGGMKGLMRNMKGMMGAMGGRGGMPFR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagtcccttacccaacgtctctccggcaccatggagcgcctgcgtggccgtggc
cgcctgaccgaggagaacatccgcgaagccacccgtgaggtgcgcattgcgctgctggag
gccgacgtcgcgctgccggtggtacaggccctgatcgaacgcatcaaggtgcgtgcagta
ggccaggaagtgctcaagtcgctgaccccgggccaggcgctgatcaagatcgtgcgcgac
gagctcaccgccgtcatgggcgccgccgctgccgacctcaacctcaatgtgccggcgccg
gccatcatcctgatggcgggcctgcagggtgcgggcaagaccaccaccgtgggcaagctc
gccaagcacatgaaggaaaagcgcaagaagaaggtcatggtggtctcggccgacgtctat
cgcccggccgcgattgagcagctcaagaccctggccgaacaggtcggtgtgctgttcttc
ccctccgatgcctcgcagaagccggtggacatcgtgcgtgcggccatcagcgatgcacgc
aagtccttcgccgacgtgctgctggtcgataccgccggccgcctggcgatcgatgcggcg
atgatggacgagatcaaggcgctgcacgccgcggtcaatcccaccgaaaccctgttcgtg
gtcgatgcgatgaccggccaggacgcggccaacaccgccaaggccttcggtgaggcactg
ccgctcaccggcgtggtgctgaccaagaccgacggcgacgcgcgcggcggtgcggccctg
agcgtgcgctacatcaccggcaagccgatcaagttcgtcggtaccggcgaaaagaccgac
ggcctggacgtgtttcatccggaccgcgtggccagccgcatcctggacatgggcgacgtg
ctgtcgctggtggagcaggtcgaacacagcgtcgaccaggaaaaggccgccaagctcgcc
gccaaggtcgccaagggcaagaagttcgacctcaacgacatgaaggaacagcttgagcag
atgcagaacatgggcggcatccatgggctgatggacaagctgccgggcatgggccagatc
ccggacaacgtcaagcagcaggtcaccggcaaggaagtgccgcgcatgatcgccatcatc
aactcgatgaccaagaaggaacgccgcaacccggccttgctcaacggctcgcgccgcgcc
cgcatcgcgcgcggctccggcatgcagccggccgacgtgaacaagctgatgaagcagtac
cagcagatggaaaagatgatgggcaagctggccggcggcggcatgaagggcctgatgcgc
aacatgaaaggcatgatgggcgccatgggcggccgcggtggtatgccgttccgctga

DBGET integrated database retrieval system