KEGG   Xanthomonas campestris pv. campestris 8004: XC_3266Help
Entry
XC_3266           CDS       T00247                                 

Definition
(GenBank) peptidyl-prolyl cis-trans isomerase
  KO
K03545  trigger factor
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    XC_3266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trigger_C Trigger_N
Motif
Other DBs
NCBI-ProteinID: AAY50310
UniProt: Q4URL3
Position
complement(3910497..3911789)
Genome map
AA seq 430 aa AA seqDB search
MQASIESTGNLERRLTFTLPQERLETHVGGRLRELARTTRIKGFRPGKVPTKVIEQRFGQ
QVRAEAMEGLLRETFDSAVREHSLRLAGNPRIDQGESDFDFVATFEVVPDFGDIDVTNLS
VVRHTAEVTDADIDQMIENLRLQRRTWNPVERGAQVGDLVALETWSQAGNERLPAEGVET
GSSVLGSGVMFDQIEKGLEGLSKGEDKALSIDFPADWRVPQLAGKTVQVHVKAVEVSEPV
LPEVNKEFIKSFGVKSGDAEQFRADIRTNLERELKGALMNRLRREVGEQLIAAYAHVEMP
PRLVENEARSMLAQQVDQMRRSGRNPGEIPADAHQGFMDAAAKRVLVGLLVGEVARRNEL
RLESKRVSETLRLIASTYEEPEQVIEMYRNDPQLMSGLQSRVMEEQVIDWIAERAKHTEQ
SLSFQDAIRV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcatcgatcgaatccaccggcaatctggaacgccgtctgaccttcaccctgccg
caggagcgcctggagacgcatgttggtggtcgcctgcgcgaactggcgcggaccacgcgc
atcaagggcttccggcccggcaaggtgccgaccaaggtcatcgagcagcgcttcggtcag
caggtgcgtgccgaggcgatggaaggcctgttgcgtgagaccttcgattcggcggtgcgc
gagcactcgctgcgtctggccggcaacccacgcatcgaccagggcgagagcgatttcgat
ttcgtcgccaccttcgaagtggtgccggatttcggcgacatcgacgtgaccaacctgtcg
gtggtgcgtcacaccgctgaagtcaccgatgccgacatcgaccagatgatcgagaacctg
cgtctgcagcgccgcacctggaacccggtcgagcgcggcgcgcaggtcggtgatctggtc
gcgctggagacctggtcgcaggccggcaacgagcgtctgcccgctgaaggcgtggagacc
ggcagcagcgtgctgggctcgggcgtgatgttcgaccaaatcgaaaaaggcctggaaggc
ctgtccaagggcgaagacaaggccctgagcatcgatttcccggcggactggcgcgtgccg
cagctggctggcaagacggtgcaggtgcacgtcaaggcggtcgaggtgtccgagccggtg
ctgccggaagtcaacaaggagttcatcaagagcttcggcgtgaagagtggcgatgccgag
cagttccgcgccgacatccgcaccaatctggagcgcgagctcaagggtgcgctgatgaac
cgtctgcgccgtgaagtgggcgagcaactgatcgccgcctacgcgcacgtggaaatgccg
ccgcgcctggtcgagaacgaagcccgttcgatgctggcgcaacaggtcgaccagatgcgt
cgcagcggccgcaacccgggcgagatcccggccgatgcgcaccaggggttcatggacgcc
gctgccaaacgcgtgctggtaggcctgctggtgggcgaagtcgcacgtcgcaatgagctg
cgcctggaatccaagcgtgtcagcgaaacgctgcgtctgatcgcctcgacctacgaggag
ccggaacaggtcattgagatgtaccgcaacgacccccaactgatgagtgggctgcagagc
cgtgtgatggaggagcaggtgatcgactggatcgccgagcgcgccaagcacaccgagcag
tcgctttcgttccaggacgcgattcgcgtttaa

DBGET integrated database retrieval system