KEGG   Xanthomonas campestris pv. campestris 8004: XC_3441Help
Entry
XC_3441           CDS       T00247                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    XC_3441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 N_BRCA1_IG Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: AAY50485
UniProt: Q4UR38
Position
4091829..4092212
Genome map
AA seq 127 aa AA seqDB search
MQDDPRYRVEVEVSPRFLAHQSTPEEGRYAFAYSIRIQNAGAVPARLIARHWKITDANGR
TEQVDGEGVVGEQPRLRPGEAFHYTSGVLLETEQGQMQGYYDMVADDGTEFTAPIAAFVL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgatccgcgctaccgggtcgaggtcgaggtgtcaccacgcttcctcgcccat
caatcgactccggaagaaggccgctacgccttcgcttacagcattcgcatccagaacgcc
ggcgccgtgccagcgcgactgattgcgcgccactggaaaatcaccgacgccaacggccgc
accgagcaggtggacggcgaaggtgtggtcggcgagcagccgcggttgcgtccgggcgag
gccttccactacacctccggtgtgctgctggaaaccgaacaggggcagatgcagggctac
tacgacatggtggccgacgatggcaccgaattcaccgcgccaatcgccgccttcgtgctg
agcgtgccgaggacgctgcactga

DBGET integrated database retrieval system