KEGG   Xanthomonas campestris pv. campestris 8004: XC_3611Help
Entry
XC_3611           CDS       T00247                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00521  Streptomycin biosynthesis
xcb00523  Polyketide sugar unit biosynthesis
xcb01130  Biosynthesis of antibiotics
Module
xcb_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    XC_3611
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XC_3611
Enzymes [BR:xcb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     XC_3611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AAY50653
UniProt: A0A0H2XCQ9
Position
complement(4292851..4293408)
Genome map
AA seq 185 aa AA seqDB search
MKVIETTLPGCVVIEPAVFGDERGQFFETWNAERFGQHGLPTSFVQSNVSTSARGVLRGL
HYQWPRPQGKLVSVLEGEVYDVAVDIRAGSPHFGRWTAVLLSAENRRQVWIPEGFAHGFA
VLSEKALFSYLCTDVYVKEADAGVRWDDAAIGIDWPVSDPSLSAKDAKAPFLDEVPVDRL
PVYRP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtgatcgaaacgacgttgcccggctgcgtcgtcatcgagcctgcggtcttcggt
gatgagcgcggtcagttcttcgaaacatggaatgcggagcgctttgggcagcacggcctg
ccgacgagttttgttcaaagtaacgtctccacgtccgccaggggcgtgctacgtggtctg
cactatcagtggcctcgaccgcagggcaaattggtgagcgtgcttgaaggcgaggtgtac
gatgtcgcggtggatatccgcgctgggtctccccacttcgggcgttggaccgctgtttta
ctgagcgcagaaaatcgacgccaagtctggatacctgaaggctttgcacatggtttcgca
gtactttcagagaaagcattgttcagctatctgtgcaccgatgtgtacgtcaaggaagcg
gatgcaggcgtgcgttgggacgatgcggcgatcgggatcgattggccggtcagcgatccg
tcgctgtccgccaaggatgccaaggcgccgttcctggatgaggtgccagtcgatcgtttg
ccggtgtataggccgtga

DBGET integrated database retrieval system