KEGG   Xanthomonas campestris pv. campestris 8004: XC_3641Help
Entry
XC_3641           CDS       T00247                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00350  Tyrosine metabolism
xcb00643  Styrene degradation
xcb01100  Metabolic pathways
xcb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    XC_3641
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    XC_3641
Enzymes [BR:xcb01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     XC_3641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C GST_C_5 Tom37
Motif
Other DBs
NCBI-ProteinID: AAY50682
UniProt: A0A0H2XBA2
Position
complement(4323719..4324393)
Genome map
AA seq 224 aa AA seqDB search
MSRPLELFSYWRSSAAYRVRIGLQLKALAYVAHPVHLVRDGGEQHAAAYAQLNPQELVPT
LRHGQVVIPQSLAILEYLDEAFADSAPLLPTGPAARARVRALAQVIACDVHPLNNLRVTQ
FLEHTWDVSPAQRHHWTAHWTAHWMQQGLAALETHLAGDAQTGQFCHGDTPGLADCVLVP
QLYNARRFAVELAPYPTLQRIEQACLALPAFDAARPETQPDAAV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcccctggagctgttttcgtactggcgctccagcgccgcctatcgcgtacgc
atcgggctgcagctgaaggcgctggcctacgtcgcgcacccggtgcatctggtgcgcgat
ggcggcgagcaacacgccgccgcttacgcgcaactcaacccgcaggagctggtgccgacg
ctgcggcacgggcaggtggtgatcccgcagtccctggccatcctcgaatacctggacgag
gcatttgcggacagcgcgccgctgttgccgaccggccccgccgcgcgtgcgcgggtgcgg
gcgctggcacaggtgatcgcttgcgatgtgcacccgctcaacaacctgcgcgttacccaa
ttcctggagcacacctgggacgtctcgccagcgcagcgccatcactggactgcgcactgg
actgcgcactggatgcagcaaggcttggcagcgctggaaacccacctggcgggcgacgca
cagaccgggcagttctgccacggcgacacgccgggcctggccgattgcgtgctggtgccg
cagctctacaacgcgcggcggttcgccgtggagttggcgccgtatccgacgctgcagcgg
atcgaacaggcctgcctggcactgccggcgttcgatgcggcacggccggaaacgcagcct
gacgcggcagtctag

DBGET integrated database retrieval system