KEGG   Xanthomonas campestris pv. campestris 8004: XC_4082Help
Entry
XC_4082           CDS       T00247                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00030  Pentose phosphate pathway
xcb00480  Glutathione metabolism
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01130  Biosynthesis of antibiotics
xcb01200  Carbon metabolism
Module
xcb_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
xcb_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
xcb_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:xcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XC_4082
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XC_4082
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcb04147]
    XC_4082
Enzymes [BR:xcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     XC_4082
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     XC_4082
Exosome [BR:xcb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   XC_4082
  Exosomal proteins of colorectal cancer cells
   XC_4082
  Exosomal proteins of bladder cancer cells
   XC_4082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AAY51121
UniProt: A0A0H2XC19
Position
complement(4807606..4809528)
Genome map
AA seq 640 aa AA seqDB search
MQRRGPARRRVRPAQQTHAWQLPARVFPRGPGQCGIAPAWTHGREGDASMSEQVTTPPCI
IVVFGARGDLTRRLVMPALYNLRRAGALGEEFAIVGMDHGDITERAWRTNMGKAMTELLS
SRDAEFQADGFDTDTWDWLRERMHYVRGDFTDLRAYQSLDGVLEKLHKRYGTRGNVLFYL
ATAARFFEPVLLNLGEAGLVKQREGAGWRRVIVEKPFGHDLPSAKHLNATVARVLHEDQV
FRIDHFLGKETVQNILAFRFANGLFEPVWNRDRIDHVQITAAETIGVEGRGRFYDPTGCL
RDMVPNHLFQLLAMIAMEPPAAFTTEAMHRRRAEVIEAVRPIKPEDVVRGQYASGAVNRS
AVPGYREEDTVPDESETETFVAMKLQVDTWRWAGVPFYLRTGKRLRERTTEIAIRFKPAP
LAPFRSTEVGGYGPDWLVLHIQPDEGISLQFDVKRPGAQVALAPVRMDFRYRDWFPKEYT
VGYERLLQDCMNGEAGLFQDAAMVEGAWRIVQPILDAWKQPPSDFPNYAAGSAGPSAADA
LLAMNGGHAWRALTPGRKPPPRRPPEARAGAAAPAKKSAKKAVKKAAKKVAKAPAKRSAA
VAGKSAAAASPSKAASKAVTKRATKKATKPATKVVKKSAS
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacgacgtgggcctgctcgccgaagagtacgacccgcgcagcaaacgcatgcttgg
caacttcccgcaagggtattcccacgtggccctggtcaatgcggcattgcgcctgcatgg
acgcatgggcgagaaggagacgcatccatgagtgagcaagtgaccaccccgccgtgcatc
atcgtggtgttcggtgcgcgcggtgacctgacccggcgcctggtgatgccggcgctgtac
aacctgcgccgcgccggtgcacttggcgaggaattcgccattgtcggcatggaccacggc
gacatcaccgagcgtgcctggcgcaccaacatgggcaaggcgatgaccgagctgctgagc
agccgcgatgccgagttccaggccgatggattcgataccgacacctgggactggttgcgc
gagcgcatgcattacgtgcgcggcgacttcaccgacctgcgtgcctatcagtcgctggac
ggcgtgctggaaaaactgcacaagcgctatggcacccgcggtaatgtgctgttctatctg
gccaccgccgcgcgcttcttcgagccggtgctgctgaatctgggcgaggccgggctggtc
aagcagcgcgagggcgccggctggcgccgggtgatcgtggaaaagccgttcggccacgac
ctgcccagcgccaagcatctcaatgccacggttgcgcgcgtgctgcacgaagaccaggtg
ttccgcatcgaccatttcctgggcaaggaaaccgtgcagaacatcctggcgttccgcttc
gccaatggcctgttcgagccggtgtggaaccgcgaccggatcgaccacgtgcagatcact
gccgccgaaaccatcggtgtggaagggcgcgggcgtttctacgatcccaccggctgcctg
cgcgacatggtgcccaaccatctgttccagctgctggcgatgattgcgatggagccgccg
gccgcgttcaccaccgaggcgatgcatcgccgccgcgccgaagtgatcgaagcggtgcgc
ccgatcaaacctgaagacgtggtgcgtgggcagtacgcgtccggtgcggtcaatcgcagc
gccgtgccgggataccgcgaagaagacacggtaccggacgagtcggaaaccgaaaccttc
gtggcgatgaagttgcaggtcgacacctggcgctgggccggcgtgccgttctatctgcgc
accggcaagcgcctgcgcgaacgcaccaccgagattgcgatccgcttcaagcctgcaccg
ttggcgccattccgcagcaccgaagtgggcggctacggccccgactggctggtgctgcat
atccagcccgacgaaggcatctcgctgcagttcgacgtcaagcgcccgggcgcgcaagtg
gcgttggcgccggtgcggatggacttccgctaccgcgactggttcccgaaggaatacacc
gttggctacgagcgcttgctgcaggactgcatgaatggcgaggccggtctgttccaggat
gcagcgatggtggaaggcgcgtggcgcatcgtgcagccgatcctggatgcgtggaagcaa
ccgcccagtgactttcccaattacgcggctggcagtgccggcccgtcggcggccgatgcg
ttgctggcgatgaacggcgggcacgcctggcgtgcgctcactccgggccgcaaaccgccg
ccgcgtcgcccgcctgaagcgcgtgcgggtgcggcggcaccggcgaagaagagcgccaag
aaggcggtcaaaaaggctgcgaaaaaagtcgccaaggcgcctgccaagcgcagcgctgcg
gttgccgggaaatctgcagcggcggcgtcgccgagcaaggcggcaagcaaggcggtcacc
aagcgcgccaccaaaaaggcgacgaagccggcaaccaaagtcgtcaagaagagcgcttcg
tag

DBGET integrated database retrieval system