KEGG   Xanthomonas campestris pv. campestris 8004: XC_4149Help
Entry
XC_4149           CDS       T00247                                 

Definition
(GenBank) acetyl coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xcb  Xanthomonas campestris pv. campestris 8004
Pathway
xcb00010  Glycolysis / Gluconeogenesis
xcb00620  Pyruvate metabolism
xcb00640  Propanoate metabolism
xcb00680  Methane metabolism
xcb01100  Metabolic pathways
xcb01110  Biosynthesis of secondary metabolites
xcb01120  Microbial metabolism in diverse environments
xcb01130  Biosynthesis of antibiotics
xcb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XC_4149
   00620 Pyruvate metabolism
    XC_4149
   00640 Propanoate metabolism
    XC_4149
  Energy metabolism
   00680 Methane metabolism
    XC_4149
Enzymes [BR:xcb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     XC_4149
Lipid biosynthesis proteins [BR:xcb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   XC_4149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AAY51188
UniProt: Q4UP35
Position
4891000..4892943
Genome map
AA seq 647 aa AA seqDB search
MADVYPVDPAFAADARITREQYATLYRESIEHPEQFWGKAAQRLDWFKQPTQIKDVSFAL
DDFHVRWFGDGELNASVNCLDRQLATRGDKTALLFEPDSPDSPSYPVTYRELYERVCKLG
NALRNLGVKKGDRVTIYLPMIVDAAVAMLACARIGAVHSVVFGGFAANSIADRVIDCQSK
LIITADEGLRGGKKIPLKANVDAALKIPGTNTVETVLVVRHTGGAVDMQAPRDRWFHDVV
DGQPAECEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLFASYTHEVVFDLREDDIY
WCTADVGWVTGHSYIVYGPLANGATAVMFEGVPNYPNVSRFWEVIDKHQVTIFYTAPTAI
RALMREGEAPVKKTSRSSLRLLGSVGEPINPEAWRWYYEVVGDSRCPIVDTWWQTETGGI
LISPLAGAVDLKPGSATLPFFGVQPALVDAEGKILEGATEGNLVLLDSWPGQMRTVYGDH
QRFIDTYFRTYPGSYFTGDGCRRDADGYYWITGRVDDVINVSGHRIGTAEVESALVSHPK
VAEAAVVGFPHDVKGQGIYAYVTLIAGETPSEELHKELVSWVRKEIGPIASPDHLQWAPG
LPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSVVDSLVNERLTR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgtttatcccgtcgatcccgcgttcgccgctgatgcgcgcattacgcgcgag
cagtacgcaacgctgtaccgcgaatcgatcgaacaccccgagcagttctggggcaaggcc
gcgcagcggctggactggttcaagcaacccacccagatcaaggacgtcagcttcgcgctg
gacgacttccacgtgcgctggttcggcgacggcgaactcaatgccagcgtcaactgcctg
gaccgccagctggccacccgcggcgacaagaccgcgctgctgttcgaacccgacagcccg
gattcgccgtcctacccggtcacctaccgcgagctctatgagcgcgtgtgcaagctgggc
aacgcgctgcgcaacctgggcgtcaagaagggcgaccgggtcaccatctatctgccgatg
atcgtcgatgcggccgtggcgatgctcgcctgcgcgcgcatcggtgcggtgcactcggtg
gtgtttggcggctttgcggccaactccatcgccgaccgcgtgatcgactgccagagcaag
ctgatcatcaccgccgacgaaggcctgcgcggcggcaagaagatcccgctcaaggcgaac
gtggacgcggcgctgaagatccccggcaccaacacggtcgaaaccgtgctggtggtgcgc
cacaccggcggtgcagtggacatgcaggccccgcgcgaccgctggttccatgacgtggtc
gatggccagccggccgagtgcgaacccgagcgcatgaacgcggaagacccgttgttcatc
ctctacacctccgggtccacaggcaagcccaagggcgtgctgcacaccaccgccggctac
ctgctgtttgccagctatacgcatgaagtggtgttcgacctgcgcgaggacgacatctac
tggtgcaccgccgacgtgggctgggttaccggccacagctacatcgtctacggcccgctg
gccaacggcgccaccgcggtgatgttcgaaggcgtgccgaattaccccaacgtctcgcgt
ttctgggaagtgatcgacaagcaccaggtcaccatcttctacaccgcgcccaccgccatc
cgcgcgctgatgcgcgaaggcgaagcaccggtcaagaagacctcgcgcagcagcctgcgc
ctgctcggcagcgttggcgagccgatcaatcccgaagcctggcgctggtactacgaggtg
gtcggcgacagccgttgcccgatcgtggacacctggtggcagaccgaaaccggcggcatc
ctgatctcgccgctggccggcgcggtggacctcaagcccggctcggccaccctgccgttc
ttcggcgtgcagccggccctggtcgatgccgaaggcaagatcctggaaggcgccaccgag
ggcaacctggtgctgctggattcgtggccgggccagatgcgcaccgtctacggcgaccac
cagcgcttcatcgacacctacttccgcacctacccgggtagctacttcaccggtgacggc
tgccgccgcgacgccgatggctactactggatcaccggccgcgtggacgacgtgatcaac
gtctccggccaccgcatcggcaccgccgaggtggaaagcgcgttggtgtcgcacccgaag
gtggccgaagcggccgtggtcggcttcccgcacgacgtcaagggccagggcatctacgcc
tacgtgaccctgatcgccggcgagacgcccagcgaagagctgcacaaggaactggtgagc
tgggtgcgcaaggagatcggcccgatcgcctcgccggaccatctgcaatgggccccgggc
ctgccgaagacccgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccgaaaac
gccccggatcagctgggcgatacctccacgctggccgatccatcggtggtggattcgctg
gtcaatgagcggctgacgcgctga

DBGET integrated database retrieval system