KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0020Help
Entry
XCC0020           CDS       T00083                                 

Gene name
serA
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00260  Glycine, serine and threonine metabolism
xcc00680  Methane metabolism
xcc01100  Metabolic pathways
xcc01120  Microbial metabolism in diverse environments
xcc01130  Biosynthesis of antibiotics
xcc01200  Carbon metabolism
xcc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xcc00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    XCC0020 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCC0020 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcc04147]
    XCC0020 (serA)
Enzymes [BR:xcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     XCC0020 (serA)
    1.1.1.399  2-oxoglutarate reductase
     XCC0020 (serA)
Exosome [BR:xcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCC0020 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 998767
NCBI-ProteinID: NP_635415
UniProt: Q8PEG0
Position
22115..23101
Genome map
AA seq 328 aa AA seqDB search
MRILVPDDYQGAVRALPCLQRLQGHEVQVLGALATDPNEWAERLVEADALVLIRERTRVD
ATLLRRLPRLKLISQTGRIGPHVDVAACTEFGVAVTEGVGSPVAPAELTWALILSASRRL
TEYQRALHQGRWQALGDSALGRTLHGRTLGIWSYGRIGQRVAAFGRAFGMHVLVWGGEVS
CAQAARDGYAIADSREALFERSDVLSLHRRLSAQTRHDVTTADLLRMRPDALLVNTSRAE
LIAPGALIAALDAGRPGHAAVDVFEREPVLDARDPLLQHPRVLATPHLGYVERDSYAAYF
EAAFDNVLAFAAGTPRNLVNPEALLVAR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattctggtgccggacgattaccagggcgccgtgcgcgccctgccctgcctgcag
cgtctgcagggccatgaagtgcaggtgctgggcgcgctggccaccgatcccaacgaatgg
gccgagcggctggtggaagccgatgcgctggtattgatccgcgaacgtacccgcgtggac
gccacgttgctgcggcgcctgccgcggttgaaactgatcagccagaccggccgcattggc
ccgcatgtggatgtggcggcctgcaccgagtttggcgtggcggtcaccgagggcgtgggc
tcgccggtcgcgccggccgagttgacctgggcgttgatcctgtccgccagccggcgcctg
accgaataccagcgcgccctgcatcaaggccgctggcaggcgctgggcgattccgcgttg
gggcgcaccttgcatgggcgcacgctgggcatctggagctacggccgtatcggccaacgc
gtggccgcattcgggcgggcgtttggcatgcacgtgctggtgtggggcggtgaagtgtcg
tgcgcgcaggcggcgcgcgatggctatgcaatcgccgacagccgagaggctttgttcgaa
cgcagcgatgtgctgtcgctgcaccggcgcctgagcgcgcagacccggcatgacgtgacc
accgccgacctgctgcgcatgcgccccgacgcgttgctggtcaacaccagccgcgcagag
ctgatcgcaccgggcgcgttgatcgcggccctggacgccggccgccctgggcacgccgcc
gtggatgtgttcgagcgcgaaccggtcctggatgcgcgcgacccgctgctgcaacacccg
cgcgtgctggccaccccgcacctgggctatgtggaacgcgacagctacgcggcttacttc
gaggccgcattcgacaacgtgctggcgttcgctgctggcacaccgcgcaacctggtcaat
cctgaggcgttgctggttgcgcgttag

DBGET integrated database retrieval system