KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0106Help
Entry
XCC0106           CDS       T00083                                 

Gene name
lldD
Definition
(RefSeq) L-lactate dehydrogenase
  KO
K00101  L-lactate dehydrogenase (cytochrome) [EC:1.1.2.3]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00620  Pyruvate metabolism
xcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCC0106 (lldD)
Enzymes [BR:xcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.2  With a cytochrome as acceptor
    1.1.2.3  L-lactate dehydrogenase (cytochrome)
     XCC0106 (lldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_dh IMPDH NMO Glu_synthase ThiG IGPS DHO_dh His_biosynth
Motif
Other DBs
NCBI-GeneID: 1002315
NCBI-ProteinID: NP_635501
UniProt: Q8PE75
Position
complement(131309..132469)
Genome map
AA seq 386 aa AA seqDB search
MIISAASDYRAAAEARLPPFLFHYIDGGAYAEHTLRRNVSDLADIALRQRVLRNMSDLSL
STELFGETLAMPVALAPVGLTGMYARRGEVQAARAAAARGIPFTLSTVSVCPIEEVAPAI
DRPMWFQLYVLKDRGFMRNALERAKTAGVTTLVFTVDMPTPGARYRDAHSGMSGPNASLR
RMLQAMTHPRWAWDVGLLGKPHDLGNISTYRGSPTGLQDYIGWLAANFDPSISWKDLEWI
REFWTGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGE
LKILADSGIRSGLDVVRMLALGADAVLLGRAFVYALAAGGQAGVENLLTLIEREMRVAMI
LTGTHSVAEISGDALSRVTREAAVVP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgatcatttctgccgcttccgattaccgcgccgccgccgaagcccgcttgccgccgttc
ctgttccactacattgatggcggcgcgtatgccgagcacaccttgcggcgcaatgtctcg
gacctggcggatatcgcgttgcgtcagcgcgtgctgcgcaatatgtccgatctcagcctg
agcaccgagctgttcggcgagacgctggcgatgccggtggcgctggcaccggtggggctc
accggcatgtacgcacgccgcggcgaagtgcaggccgcgcgtgcagccgctgcgcgcggc
attccgttcacgctgtccacggtgtcggtgtgcccgatcgaggaagtggcaccagcgatc
gaccgcccgatgtggttccagctgtatgtgctcaaggaccgcggcttcatgcgcaacgcg
ctggagcgcgccaagaccgccggggtgaccacgctggtgttcacggtggacatgcccacg
cccggcgcgcgctaccgcgatgcgcactcgggcatgagcgggcctaacgcgtcgctgcgg
cgcatgctgcaggcgatgacgcacccgcgctgggcgtgggacgtgggcctgctcggcaaa
ccgcatgacctgggcaacatctccacctaccgcggcagccccaccggattgcaggattac
atcggctggctggcggccaatttcgacccctccatctcgtggaaggacctggaatggatc
cgcgagttctggaccgggccgatggtgatcaagggcatcctcgacccggaggacgcacgc
gacgcggtgcgcttcggcgccgacggcatcgtggtgtccaaccatggcgggcgccagctc
gatggcgtgctgtccagcgcgcgcgcattgccggcgattgccgatgcagtgaagggcgag
ctgaagatcctggccgactcgggcattcgcagtgggttagatgtggtgcgcatgctggcg
ctgggtgccgatgccgtattgctcggccgcgcgttcgtctacgcactggccgccggcggc
caggccggcgtggaaaacctgctgaccctgatcgagcgcgagatgcgcgtggcgatgatc
ctcaccggcacgcattcggtggccgagatcagcggcgacgcgttgagccgggtaacgcgc
gaggcggcggttgtgccttga

DBGET integrated database retrieval system