KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0194Help
Entry
XCC0194           CDS       T00083                                 

Gene name
yfcY
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00071  Fatty acid degradation
xcc00072  Synthesis and degradation of ketone bodies
xcc00280  Valine, leucine and isoleucine degradation
xcc00310  Lysine degradation
xcc00362  Benzoate degradation
xcc00380  Tryptophan metabolism
xcc00620  Pyruvate metabolism
xcc00630  Glyoxylate and dicarboxylate metabolism
xcc00640  Propanoate metabolism
xcc00650  Butanoate metabolism
xcc00900  Terpenoid backbone biosynthesis
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01120  Microbial metabolism in diverse environments
xcc01130  Biosynthesis of antibiotics
xcc01200  Carbon metabolism
xcc01212  Fatty acid metabolism
xcc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCC0194 (yfcY)
   00630 Glyoxylate and dicarboxylate metabolism
    XCC0194 (yfcY)
   00640 Propanoate metabolism
    XCC0194 (yfcY)
   00650 Butanoate metabolism
    XCC0194 (yfcY)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XCC0194 (yfcY)
   00072 Synthesis and degradation of ketone bodies
    XCC0194 (yfcY)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XCC0194 (yfcY)
   00310 Lysine degradation
    XCC0194 (yfcY)
   00380 Tryptophan metabolism
    XCC0194 (yfcY)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XCC0194 (yfcY)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XCC0194 (yfcY)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XCC0194 (yfcY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcc04147]
    XCC0194 (yfcY)
Enzymes [BR:xcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XCC0194 (yfcY)
Exosome [BR:xcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCC0194 (yfcY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 1000468
NCBI-ProteinID: NP_635589
UniProt: Q8PDZ0
Position
252389..253684
Genome map
AA seq 431 aa AA seqDB search
MQGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVV
MGAVIKHSSDWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIG
GGSDTTSEVPIVYGKKLRARLLAANRAKATGDKLKALLRGFKLGELKPEFPGVAEPRTGK
SMGEHCEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDSLIAPFRGVSRDNILRADT
SLEKLATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
SAVDFVHGEGLLMAPTVAVPQMLARHGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtcagccgatgcccgcagcccgtcccgtcgccatcctgggcggcgttcgtatc
ccgttctgtcgccagaacaccgcatacgcggacgtgggcaacctgggcatgtcggtgcgc
accctgggcgcgctggtcgaacgcttcgggctgcatggccagcaactgggcgaggtggtg
atgggggcggtgatcaagcattcctccgactggaacctggcccgcgaagccgcgctgtcg
tcgggcctgtcgccgctcacgccgggcatcaccctgcagcgcgcctgtggcaccagcctg
gactcggtgatcaccatcgccaacaagatcgcgctggggcagatcgactcgggcatcggc
ggcggctcggacaccacctccgaggtgccgatcgtctacggcaagaagctgcgggcgcgc
ctgctggccgccaaccgcgccaaggccaccggcgacaagctcaaggcgctgctgcgcggt
ttcaagctgggcgagctcaagcccgagttccccggcgtggccgagccgcgcaccggcaag
agcatgggcgaacactgcgaagacatggccaaggaatggaacatctcgcgtgattcgcag
gacgaatgggcagtggcttcgcaccacaagttggccgccgcgtatgagcgcgggtttttc
gattcgctgattgccccgttccgtggcgtgtcgcgcgacaacatcctgcgcgccgacacc
tcgctggaaaagctggccacgttgcgcccggcgttcgacaagacctccggccgcggcacg
ctcaccgccgccaattccaccccgctcaccgatggcgccgccgcggtgctgttgtccagc
gaagcctgggcgctggcccacggccacacgccgatggcctacctgcgcgatgcacaggtc
tcggcggtggatttcgtgcatggcgagggcctgctgatggcgcctacggttgcagtgccg
cagatgctggcgcggcacgggctgaccttgcaggacttcgacatctacgagatccacgaa
gccttcgccgcgcaggtgctgtgcacgctgcgcgcctgggagagcgaggattactgccgc
aatcgcctgggactggacgcgccgctgggccgcatcgacccggacaagatcaacccgctg
ggctcctcgctggccaccggccacccgtttgccgcgaccggcgcacgcgtcgtggctacc
gcagccaagcagctggaagaacgcggcggcggacgtgccctgatttcgatctgcaccgcc
ggcggcatgggcgtggtggcgatcgtggaacgctga

DBGET integrated database retrieval system