KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0427Help
Entry
XCC0427           CDS       T00083                                 

Gene name
pdhB
Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00010  Glycolysis / Gluconeogenesis
xcc00020  Citrate cycle (TCA cycle)
xcc00620  Pyruvate metabolism
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01120  Microbial metabolism in diverse environments
xcc01130  Biosynthesis of antibiotics
xcc01200  Carbon metabolism
Module
xcc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCC0427 (pdhB)
   00020 Citrate cycle (TCA cycle)
    XCC0427 (pdhB)
   00620 Pyruvate metabolism
    XCC0427 (pdhB)
Enzymes [BR:xcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     XCC0427 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 1002030
NCBI-ProteinID: NP_635821
UniProt: Q8PDB3
Position
complement(521379..522887)
Genome map
AA seq 502 aa AA seqDB search
MSEAKNFHLPDLGEGLPDATIVEWFVKEGDPVRLDDPLVSMETAKAVVEVPSPFSGTVVK
LAGAAGDVITTGAVLAQFALDASQPQRADGQDTGHSHGPAPTHAPTPSTGDSAAGHTTRV
VASDNGGEIADADAGDGSSDRDDAGTVVGAMQSSNAVQSEQAITVGGVRAMPVVRALARK
LRVDLAQVRATGPDGTVTLADVKQAAAAGTAQPSPGAQGAPTSPARGRGGPIDDGGRAAG
SAADGRDRPATAPLLPPAGEGARRADEGNARSTLSASGKPMRTQSPGISAKGQPEQLKGV
RRNMARVMADAHSKVVPTTLNDDADLHAWQPGNDVTVRLVRGIVRACEAVPALNAWFDGE
ALSRTLHPQVDIGIAVDTEEGLLVPALRNADMLDAHGIREGVNRLRQQVESRSIAASELS
GYTISLSNFGMFAGRYATPVVVPPCVAIVAAGRARYQLTPVMGGVETHKVMPLSLTFDHR
AATGGEAARFLRALLDDLALAN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagccaagaatttccacctgcccgacctgggcgaaggcctgcccgacgccacc
atcgtcgaatggttcgtcaaggagggcgaccccgtgcgcctggacgacccgctagtatcg
atggagaccgccaaggcggtggtcgaagtgccctcgccgttctccggcaccgtggtcaag
ctggccggcgcggccggcgatgtgatcaccaccggtgcggtgctggcgcagttcgcgctg
gatgcctcgcaaccgcagcgtgccgacggccaggacaccggccattcgcatggaccggcg
ccgacgcacgcacccacgcccagcaccggcgacagcgcggctgggcacaccacacgcgtg
gtggcctccgataacggcggcgaaattgccgatgccgatgctggcgatggcagcagcgat
cgcgacgatgccggcaccgtggtgggcgcgatgcagagctccaacgccgtgcagagcgag
caggccattaccgtcggcggcgtgcgcgccatgccggtggtgcgcgcgctggcgcgcaag
ctgcgtgtggacctggcacaggtgcgcgctaccggcccggacggcacggtcacgctggca
gacgtaaagcaggcagcagccgccggtaccgcgcagccctcacccggcgcgcagggcgcg
ccgacctctcctgcccgcgggagaggtggtccgatcgatgacggtgggagagctgctggg
agcgctgccgacggcagggatcgacccgcaacagcaccccttcttccgcctgcgggagaa
ggtgcccgcagggcggacgaaggcaacgcccgctccacgctgtcggccagcggcaagccg
atgcgcacccagtcgcccggcatcagcgccaagggccaacccgagcaactcaagggcgtg
cgccgcaacatggcacgcgtgatggccgatgcgcacagcaaggtggtgcccaccacgctc
aacgacgacgccgacctgcacgcctggcaacccggcaacgacgtcacagtgcgcctggtg
cgcggcatcgtgcgcgcctgcgaggccgtgcccgcgctcaacgcctggttcgacggcgag
gcgctgagccgcacgctgcacccgcaggtggacatcggcattgcggtagacaccgaagaa
ggcctgttagtgccggcactgcgcaacgccgacatgctggatgcgcatggcattcgcgaa
ggcgtcaaccggctgcgccagcaggtggaaagccgcagcatcgccgcgtccgaactgagc
ggctacaccatctcgctgtccaacttcggcatgtttgccggccgctacgccacgccggtg
gtggtgccgccctgcgtggcgatcgtggccgccggccgcgcgcgctaccagctcaccccg
gtgatgggcggcgtggaaacccacaaggtgatgccgctgtcgctgaccttcgatcaccgc
gccgccaccggcggtgaagcggcgcgcttcctgcgcgccttgctggacgatctggcgttg
gccaactga

DBGET integrated database retrieval system