KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC0470Help
Entry
XCC0470           CDS       T00083                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01130  Biosynthesis of antibiotics
xcc01230  Biosynthesis of amino acids
Module
xcc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XCC0470 (trpC)
Enzymes [BR:xcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     XCC0470 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh
Motif
Other DBs
NCBI-GeneID: 999264
NCBI-ProteinID: NP_635864
UniProt: Q8PD70
Position
571780..572577
Genome map
AA seq 265 aa AA seqDB search
MSDILNTILARKADEIAERSARVPLAELVARSADLPLTRGFAAAMKASIAAGEPAVIAEV
KKASPSKGVIRPDFHPADIAVSYEFGGASCLSVLTDMYFFQGSDAYLQQAREACTLPVLR
KDFTVDPYQVYEARVLGADCILLIVSALEDQQLADLSGLAMQLGLDVLVEVHDIDELERA
VQVPVPLVGINNRNLRTFEVSLQTTLDMRAAVPRDRVLVTESGIVTASDVQLMRSNGVNA
FLVGETFMRAPEPGEALRQLFFAHD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatattctcaacaccatccttgcccgcaaggccgacgaaatcgccgagcgcagc
gcacgcgtgccgctggccgagctggtcgcgcgtagcgcagacctgccgctcacccgcgga
tttgccgccgccatgaaggccagcattgccgccggcgagccagccgtgattgccgaagta
aagaaggccagcccgtccaagggcgtgatccggcccgacttccatccggctgacatcgcg
gtcagctacgagttcggtggtgccagctgcctgtcggtgctgaccgacatgtatttcttc
cagggctccgatgcgtatctgcagcaggcacgcgaggcctgcaccttgccggtgctgcgc
aaggatttcaccgtcgatccgtaccaggtctacgaggcgcgcgtgctgggcgccgactgc
atcctgctgatcgtctcggcgctggaggaccagcaactggccgacctgtccggtctggcg
atgcagttgggcctggatgtgctggtggaagtgcacgacatcgacgagctcgagcgtgcg
gtgcaggtgccggtgccgctggtgggcatcaacaaccgcaacctgcgcaccttcgaggtg
tcgttgcagaccaccctggacatgcgcgcagctgtgccgcgtgatcgcgtcctggtcacc
gaaagcggcatcgtcaccgcatccgacgtgcagttgatgcgcagcaacggcgtgaacgcg
tttctggtcggcgagaccttcatgcgcgcgcccgaacccggcgaagcactgcgtcagcta
ttctttgcgcatgactga

DBGET integrated database retrieval system