KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1297Help
Entry
XCC1297           CDS       T00083                                 

Gene name
atoB
Definition
(RefSeq) acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00071  Fatty acid degradation
xcc00072  Synthesis and degradation of ketone bodies
xcc00280  Valine, leucine and isoleucine degradation
xcc00310  Lysine degradation
xcc00362  Benzoate degradation
xcc00380  Tryptophan metabolism
xcc00620  Pyruvate metabolism
xcc00630  Glyoxylate and dicarboxylate metabolism
xcc00640  Propanoate metabolism
xcc00650  Butanoate metabolism
xcc00900  Terpenoid backbone biosynthesis
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01120  Microbial metabolism in diverse environments
xcc01130  Biosynthesis of antibiotics
xcc01200  Carbon metabolism
xcc01212  Fatty acid metabolism
xcc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCC1297 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    XCC1297 (atoB)
   00640 Propanoate metabolism
    XCC1297 (atoB)
   00650 Butanoate metabolism
    XCC1297 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XCC1297 (atoB)
   00072 Synthesis and degradation of ketone bodies
    XCC1297 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XCC1297 (atoB)
   00310 Lysine degradation
    XCC1297 (atoB)
   00380 Tryptophan metabolism
    XCC1297 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XCC1297 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XCC1297 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XCC1297 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcc04147]
    XCC1297 (atoB)
Enzymes [BR:xcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XCC1297 (atoB)
Exosome [BR:xcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCC1297 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-GeneID: 1001699
NCBI-ProteinID: NP_636671
UniProt: Q8PB29
Position
complement(1515105..1516280)
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAAKRTAIGSFLGQFNGVPAPTLAAAAIEGALAQSGVAAADVSEVIVGCVLPAN
LGQAPARQAAIAAGIPTSTGATTINKVCGSGMKAIMFGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGVFGEATAEKFGFSRADQDAYAI
ASVERAQAAQRNGSFADEIVPVKVATRKGEIVVDSDEQPGKSDMAKIPTLKAAFKKDGTV
TAASSSSISDGAAITVLMAADEAQRRGITPLARIVGHVTHSQAPEWFTTAPVAAIQSLVG
KIGWTLDDVDLFEINEAFAVVAMTPIKELGIAHEKVNVHGGACALGHPIGASGARLVVTL
VNALRSRGGKRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgttgctgcaaaacgcactgccatcggatcgttccttggccag
ttcaatggcgtccccgcccccacgcttgctgctgccgccattgaaggcgcgctggcgcag
tcgggcgttgccgcggccgatgtctccgaagtgatcgtcggctgcgtgttgcccgccaac
ctgggccaggcgcctgcgcgccaggccgccattgcggccggcatcccgacctcgaccggc
gccaccaccatcaacaaggtgtgcggttcgggcatgaaggcaatcatgttcggccacgac
ctgatcaaggccggttcggccagcatcgtggtggccggcggcatggagtcgatgagcaac
gcgccgcatctgctgccgaactcgcgcaccggcaaccgctacggcaattttcaggcggtg
gaccacatggcgtgggacggtctgaccaatccctacgatggccaggcgatgggcgtgttc
ggcgaagccactgccgagaagttcggcttctcgcgcgccgatcaggatgcctatgccatc
gcctcggtagaacgtgcacaggctgcgcaacgcaacggctcatttgccgatgaaatcgtg
ccggtgaaagtcgccacccgcaaaggcgagatcgtcgtggatagcgacgagcagcccggc
aaatccgacatggccaagatccccaccttgaaggcggcgttcaagaaggacggcactgtc
accgccgctagctcgtcgagcatttccgatggcgccgcaatcaccgtgctgatggcggcc
gatgaggcgcagcgccgcggtatcacaccgctggcgcgcatcgtgggccatgtcacccat
tcgcaggcaccggaatggttcaccaccgcgccagtggccgcgatccagtcgctggtcggc
aagatcggctggacgctggacgacgtggacctgtttgaaatcaatgaagcgttcgccgtg
gtggcgatgacaccgatcaaggaattgggaattgcacacgagaaggtcaacgtgcacggc
ggtgcctgcgcgctcggccacccgatcggtgcatccggtgcacgcttggtggtgacattg
gtgaatgcgttgcgcagccgcggcggcaagcgcggaatcgcgacgctatgcatcggcggc
ggcgaagcaactgccattgctatcgaattgatttga

DBGET integrated database retrieval system