KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC1691Help
Entry
XCC1691           CDS       T00083                                 

Gene name
pitA
Definition
(RefSeq) transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Brite
KEGG Orthology (KO) [BR:xcc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    XCC1691 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR Pilin_N
Motif
Other DBs
NCBI-GeneID: 1000848
NCBI-ProteinID: NP_637061
UniProt: Q8PA02
Position
1967082..1968209
Genome map
AA seq 375 aa AA seqDB search
MLTLVLVVILAALVFEFINGFHDTANSIATVVATKVLSPGWAVMLAAGMNLIGALTGTAV
ALTIASGLLNTNVVDVTPQVILCALLGGIIWNLITWWKGLPSSSSHALIGGLCGAGLAAA
HNNWDALIWSENIGNWAKNKGLLWKVFVPMITSPIAGFLLGIVVMLLLWALIAGMAKLGG
PIGRLARPRWVNAFFGKAQIASAAYMGYAHGHNDAQKTMGIIAMTLIGAQSAGALDDLPS
WLSFLHPGTGLAAGAGIPMWIVLTCAVVMAAGTASGGWKIIKTLGHKMVKLHPIHGFAAE
TSSATVLTVAAHFGMPVSTTHSISTAIMGVGFAKNPRSLRLGVIERIVWAWILTIPAAGG
VAYLILRGFELFGWT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
gtgcttacccttgttctggtggtgatcctggcggcgctggtgttcgagttcatcaacggc
ttccacgacaccgccaactccatcgctaccgtggtagccaccaaggtgctctcgcccggc
tgggcggtgatgctggcggccggcatgaacctcatcggcgcgctcaccggcaccgccgtg
gcgctcaccatcgcctcgggcctgctcaacaccaacgtggtggatgtcactccgcaggtg
atcctgtgcgcgctgctgggcggcatcatctggaacctgatcacctggtggaaggggctg
ccgtcgtcgtcctcgcacgccttgatcggtgggctgtgcggtgccggcctggctgccgcg
cacaacaactgggatgcgctgatctggtcggaaaacatcggcaactgggccaagaacaag
ggcctgttgtggaaagtgttcgtgccgatgatcacctcgccgatcgccggcttcctgctg
ggcatcgtggtgatgctgctgctgtgggcgttgatcgccggcatggccaagctgggcggg
ccgatcggccggctggcgcgtccgcgctgggtcaacgcgttcttcggcaaggcgcagatc
gcctcggcggcctacatgggctacgcgcacggccataacgatgcgcaaaagaccatgggc
atcatcgcgatgaccctgatcggcgcgcagtcggccggtgcgctggacgatctgccgagc
tggctgtcgtttctgcatccgggcaccgggctggccgcgggtgccggcattccgatgtgg
atcgtgctgacctgcgcagtggtgatggctgccggcaccgcttcgggcggctggaagatc
atcaagacgctcggccacaagatggtcaagttgcaccccatccacggctttgcggcggaa
accagctcggcgaccgtgctcaccgtggccgcgcatttcggcatgccggtatcgaccacg
cacagcatttccactgcgatcatgggcgtgggctttgccaagaatccgcgctcgctgcgg
ctgggcgtgatcgaacgcatcgtctgggcctggatcctcaccatcccggctgccggtggc
gtggcgtatctgatcctgcgcgggttcgaactgttcggctggacctga

DBGET integrated database retrieval system