KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2550Help
Entry
XCC2550           CDS       T00083                                 

Definition
(RefSeq) 2-hydroxyacid dehydrogenase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00030  Pentose phosphate pathway
xcc00260  Glycine, serine and threonine metabolism
xcc00620  Pyruvate metabolism
xcc00630  Glyoxylate and dicarboxylate metabolism
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XCC2550
   00620 Pyruvate metabolism
    XCC2550
   00630 Glyoxylate and dicarboxylate metabolism
    XCC2550
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XCC2550
Enzymes [BR:xcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     XCC2550
    1.1.1.81  hydroxypyruvate reductase
     XCC2550
    1.1.1.215  gluconate 2-dehydrogenase
     XCC2550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 999015
NCBI-ProteinID: NP_637898
UniProt: Q8P7R1
Position
complement(3024797..3025855)
Genome map
AA seq 352 aa AA seqDB search
MSDTARPKVWVSQPLFDDVVEQLGAHFELVTTAQVTAYSSADLAARLAPLDGALVTLNER
IGAAEIAAAPQLRAIANVGVGYNNLDIDALSAAGILASNTPDVLSETTADLGFALLMATA
RRVTEAERWLRDGQWGQWSFKTMLGADIHGSTLGILGMGRIGQGIARRGAHGFGMRVLYH
NRSQLPAETEQAVGAQYVGLDTLLAQSDHLVLVLPYTQASHHIIDAAALAKMRPTATLVN
IARGGIVDEIALADALANGRLAGAGLDVYEGEPRVRPELLAQHNVVLTPHIGSASLATRR
AMVQLAVDNLIAALGVGANAGHPPSALNADAVAAAKRGGATVGATKTAATKR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaccgcgcgccccaaggtctgggtcagccagccgttgttcgacgatgtggtc
gaacagctgggcgcgcatttcgaactggtcaccaccgcgcaggtcacggcgtattcgtcc
gccgacctcgccgcgcggctcgcgccgctggatggcgcgctggtcacgctcaacgagcgc
atcggtgcagcggaaatcgccgcagcaccgcagctgcgtgccatcgccaatgtcggggtg
ggttacaacaacctcgacatcgatgcgctgagcgcggcgggcatcctggccagcaacacg
ccggatgtgttgagcgaaaccaccgccgacctggggtttgccctgctgatggccaccgca
cgccgcgtcaccgaggccgaacgctggctacgtgacgggcagtgggggcagtggtcgttc
aagaccatgctcggcgccgatatccatggcagcacgctgggcatcctgggcatgggccgg
atcgggcagggcatcgcccggcgtggcgcgcatggcttcggcatgcgcgtgctctatcac
aaccgcagccagctgccggccgagaccgaacaggcggtgggtgcgcagtatgtcggcctc
gacaccttgctggcgcagtccgatcacctggtactggtgctgccctacacccaggcctcg
caccacatcatcgatgccgccgcgctggcgaagatgcggcccaccgccacgctggtgaac
atcgcgcgcggcgggatcgtcgatgagatcgcgctggccgatgcgttggccaatggccgc
ctcgccggtgccggtctcgatgtctacgagggcgagccccgggtgcgcccggaactgctg
gcgcagcacaacgtggtgctcaccccgcatatcggcagtgccagcctggccacgcgccgc
gccatggtgcagctggcggtggacaacctgatcgctgcgctgggcgtgggtgccaacgct
gggcatccgccgagcgcactcaacgccgatgcggtggcggctgccaaacgcggtggcgcg
accgtgggcgcgaccaaaaccgctgcgaccaaacgatag

DBGET integrated database retrieval system