KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC2943Help
Entry
XCC2943           CDS       T00083                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00010  Glycolysis / Gluconeogenesis
xcc00052  Galactose metabolism
xcc00500  Starch and sucrose metabolism
xcc00520  Amino sugar and nucleotide sugar metabolism
xcc00521  Streptomycin biosynthesis
xcc01100  Metabolic pathways
xcc01110  Biosynthesis of secondary metabolites
xcc01120  Microbial metabolism in diverse environments
xcc01130  Biosynthesis of antibiotics
xcc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XCC2943 (glk)
   00052 Galactose metabolism
    XCC2943 (glk)
   00500 Starch and sucrose metabolism
    XCC2943 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    XCC2943 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XCC2943 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    XCC2943 (glk)
Enzymes [BR:xcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     XCC2943 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 999899
NCBI-ProteinID: NP_638291
UniProt: Q8P6M4
Position
3498442..3499476
Genome map
AA seq 344 aa AA seqDB search
MAATSHSACASALPVVPAPTTFLAADVGGTHVRVGRVSHGADAPIELSQYRTYRCADHAS
LDAILADFLRDSRAVDAVVIASAGVALDDGRFISNNLPWTIAPRQLRDTLGVRAVHLVND
FEAVAYAAPQMEQRAVVQLSGPTPRHAQPGGPILVVGPGTGLGAAVWINGPRQPTVLATE
AGQVALASNDPDTAQVLRILARDASYLPIEHVLSGPGLRNLYLALCELHAATPIHPLPAD
ITHAALHSDDALARRCLQLFCALLGSAVGDMALAYGASGGVYLAGGILPSIGQFLAASDF
RERFLAKGRMRPVLERIPVKLVEHGQLGVLGAASWYLQHHTEVS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtggctgcaacctcgcactctgcttgcgcttctgctctgcccgttgtccccgctcccacc
acgtttctggctgccgatgtcggcggcacgcatgtgcgtgtcggccgggtctcgcatggc
gcggatgcgccgatcgagctctcgcagtaccgcacctaccgctgcgccgaccatgccagc
ctggacgcgatcctggctgatttcctgcgcgatagccgcgccgtcgatgcagtggtgatc
gccagcgcaggtgtcgcgctggacgacggccgcttcatcagcaacaacctgccctggacc
atcgcgccgcgtcagttgcgcgacacgcttggcgtgcgtgcggtgcatctggtcaacgac
ttcgaagcggtggcgtatgccgcgccgcagatggaacagcgtgcggtggtgcaactaagc
ggccccacgccgcggcatgcgcagcccggtggcccgatcctggtggtcggcccgggcacc
gggctaggcgctgcggtgtggatcaacggcccgcgccagccgaccgtgctcgccaccgaa
gccggccaggtcgcactggcaagcaatgaccccgacaccgcgcaggtgctgcgcatcctg
gcgcgcgacgcatcgtatctgccgatcgagcatgtgctctccggccccgggttgcgcaac
ctgtatctggcgctgtgcgaactgcacgcggccacgcccatccacccgttgcccgccgac
atcacccacgccgcgctccacagcgacgatgcactggcgcggcggtgcctgcagctgttc
tgcgcgctgctcggcagcgcggtcggcgacatggcgctggcgtacggcgcctccggcggc
gtgtatctggccggcggcatcctgccgagcatcggccagtttctggctgcgagtgatttc
cgcgaacgcttcctcgccaagggccgcatgcgcccggtgctggagcgcattccggtcaag
ttggtcgaacacgggcaactcggcgtgctcggcgcggccagctggtatctgcaacaccac
accgaggtgtcgtaa

DBGET integrated database retrieval system