KEGG   Xanthomonas campestris pv. campestris ATCC 33913: XCC3061Help
Entry
XCC3061           CDS       T00083                                 

Definition
(RefSeq) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
xcc  Xanthomonas campestris pv. campestris ATCC 33913
Pathway
xcc00860  Porphyrin and chlorophyll metabolism
xcc01100  Metabolic pathways
Module
xcc_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:xcc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XCC3061
Enzymes [BR:xcc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     XCC3061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB BPL_N
Motif
Other DBs
NCBI-GeneID: 999310
NCBI-ProteinID: NP_638408
UniProt: Q8P6A9
Position
complement(3622210..3623685)
Genome map
AA seq 491 aa AA seqDB search
MSARVLMVQGCTSDAGKSTLVAALCRWLHRQGVAVAPFKPQNMALNSAVTVDGGEIGRAQ
AVQAQACGLPPHTDFNPVLLKPNSDTGAQVIVHGHPVATLDAVGYHAYKRTARTAVLASH
ARLVERFDVLLVEGAGSPAEINLREHDIANMGYAEAVDCAVILIADIDRGGVFAHLVGTL
ALLSPSERARVAGFVINRFRGDLALLQPGLEWLERETGKPVLGVLPYLHGLQLDAEDALP
RGPVHKPQARLRVVVPVLPRISNHTDLDALLAHPQVDVQLIGPGQSPPPCDLIVLPGSKS
TRQDLAWLRAQGWEAAIARHLRYGGKLLGICGGLQMLGEQVHDPHGIEGAPGSSAGLGWL
ALQTALQPHKQLHRVGGRLLPSGAAVSGYEIHCGLSTGTALARPLLQLDDGRSDGAVSED
GQVMGTYLHGIFDHPAALAALLAWAGLADAAPLDLASLREATLERLADTVHAHLDIAALT
RLTLGEPACAN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgcgcgtgctgatggtgcagggctgcacctccgatgcgggcaagagcacgttg
gtggccgcgctgtgccgctggctgcatcgccaaggcgttgcggtggccccgttcaagccg
cagaacatggcgctcaattccgcggtcaccgtggatggcggcgaaatcggccgggcccag
gcagtgcaggcgcaggcctgcgggttgccgccgcacaccgatttcaacccggtgctgctc
aagcccaacagcgacactggcgcgcaggtcatcgtgcacgggcatccggtggccacgctg
gatgcggtggggtaccacgcctacaaacgcactgcgcgcacggcggtgctggcctcgcac
gcgcggctggtggaacgcttcgacgtgctgctggtggaaggcgccggcagcccggcggaa
atcaacctgcgtgaacacgacatcgccaatatgggttacgccgaggcggtggattgcgca
gtgatcctgatcgccgacatcgaccgcggcggcgtgttcgcccatctggtcggtacgctg
gcgttgctgtcgccgagcgagcgcgcacgggtggccggtttcgtgatcaatcgcttccgt
ggcgaccttgccttgctgcagcccggccttgagtggctggagcgcgaaaccggcaagccg
gtgctcggcgtgctgccgtatctgcatggcctgcagctcgatgccgaggatgcgttgccg
cgcggcccggtgcacaagccgcaggcgcgcctgcgcgtggtggtgccggtgttgccgcgg
atcagcaaccacaccgatctggacgccttgctggcgcacccgcaggtggacgtgcagctg
atcgggccaggccagtcaccaccgccgtgcgacctgatcgtgctgccgggcagcaagtcc
acccgccaggatctggcctggctgcgcgcgcagggctgggaagcggcgatcgcgcggcat
ctgcgctacggcggcaagctgctcggcatctgcggcggcctgcagatgctgggcgaacag
gtgcacgacccgcacggcatcgaaggcgcgcccggcagcagcgccgggctgggctggctg
gcactgcaaaccgcattgcagccgcacaagcaattgcaccgcgtcggtggccggctgctg
cccagtggcgcagcggtcagcggctacgaaatccattgcggcctcagcaccggtacggcg
ctggcgcggccgctgctgcagctggacgatggccgtagtgacggtgcagtgtccgaggat
ggtcaggtcatgggcacctatctgcacggcatcttcgaccaccccgcggcgctggccgca
ctgctcgcctgggccgggcttgccgacgctgcaccgctggatctggccagcctgcgcgaa
gcgacactcgaacgcctggccgataccgtgcacgcccatctggacatcgccgcattgacg
cggctcaccctgggggagccggcatgcgccaattga

DBGET integrated database retrieval system