KEGG   Xylanimonas cellulosilytica: Xcel_0300Help
Entry
Xcel_0300         CDS       T01135                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
xce  Xylanimonas cellulosilytica
Brite
KEGG Orthology (KO) [BR:xce00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Xcel_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1 DUF4632
Motif
Other DBs
NCBI-ProteinID: ACZ29339
UniProt: D1BUU8
Position
355467..356465
Genome map
AA seq 332 aa AA seqDB search
MEAALVVLVVALALGFDYTNGFHDAANAIATSVSTRALTPRVALVMAAVMNFAGALLGTE
VAETIAKSIVALDHASTSTELTVVLCALVGAIVWNLITWWFGLPSSSTHSLIGGLVGAGM
AGGLPIFWSAIVDKVVLPMVLSPLIGFVLAFAVMIGILWIFRNAAPARTHRRFRIAQTAS
AAAMALGHGLQDAQKTMGVIFLALLSVGWADPANGIPLWVKLAAAAAISLGTYSGGWRIM
RTLGRRIIELDPARGFVAETVSAVVLYANAFILHAPVSTTHTITSAIMGVGATRRLSAVR
WGVAKNIAVAWVLTIPASAAVAAAATWLVTVW
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtggaggctgcgctcgtcgtcctcgtggtggcgctcgccctcgggttcgactacaccaac
gggttccacgacgccgcgaacgccatcgccacctcggtgtccacgcgcgcgctgacgccg
cgcgtggccctcgtcatggccgcggtgatgaacttcgcgggtgccttgctgggcacggag
gtggccgagacgatcgccaagtcgatcgtcgcgctcgaccacgcctccacgagcaccgag
ctcacggtggtgctctgcgccctcgtgggggcgatcgtgtggaacctcatcacgtggtgg
ttcgggctgccgtcgtcgtcgacgcactcgctcatcggcggcctggtcggcgccgggatg
gccggcgggctgcccatcttctggagcgcgatcgtcgacaaggtcgtgctgccgatggtg
ctctcgccgctcatcgggttcgtcctcgcgttcgcggtgatgatcgggatcctgtggatc
ttccggaacgccgcccccgcccgtacgcaccgccgcttccggatcgcgcagacggcgtcg
gcggctgcgatggcactgggccacggtctgcaggacgcgcagaagacgatgggcgtcatc
ttcctggcgctgctctcggtcggctgggccgacccggcgaacggcatcccgctgtgggtc
aagctcgccgccgccgcggccatctcgctcggcacgtactcgggcggctggcgcatcatg
cgcaccctgggccgccgcatcatcgagctcgaccccgcgcgcgggttcgtggccgagacc
gtctccgccgtcgtgctctacgccaacgcgttcatcctgcacgccccggtgtccacgacg
cacaccatcacctcggcgatcatgggcgtcggcgccacccgccggctctcggccgtgcgc
tggggcgtcgcgaagaacatcgccgtcgcgtgggtgctgaccatcccggcctcggccgcg
gtggccgccgccgcgacgtggctcgtcaccgtgtggtga

DBGET integrated database retrieval system