KEGG   Xylanimonas cellulosilytica: Xcel_0318Help
Entry
Xcel_0318         CDS       T01135                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00010  Glycolysis / Gluconeogenesis
xce00620  Pyruvate metabolism
xce00640  Propanoate metabolism
xce00680  Methane metabolism
xce01100  Metabolic pathways
xce01110  Biosynthesis of secondary metabolites
xce01120  Microbial metabolism in diverse environments
xce01130  Biosynthesis of antibiotics
xce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_0318
   00620 Pyruvate metabolism
    Xcel_0318
   00640 Propanoate metabolism
    Xcel_0318
  Energy metabolism
   00680 Methane metabolism
    Xcel_0318
Enzymes [BR:xce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Xcel_0318
Lipid biosynthesis proteins [BR:xce01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Xcel_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N FIST
Motif
Other DBs
NCBI-ProteinID: ACZ29357
UniProt: D1BV86
Position
complement(376376..378373)
Genome map
AA seq 665 aa AA seqDB search
MTTHPEAASLENLLHETRSFPPASAFAAQANAQPSLYAEAAADRPEFWARQARELVSWRT
PFTQTLDWSDAPVARWFADGTLNAAYNAVDRHVEAGHGDRVAIHFEGEPGDTRTVTYADL
QREVARAANALAALGVSKGDRVVIYLPMLVESVVAMLACARIGAPHSVVFGGFSADALRS
RIADAEATLVITADGGYRRGAASALKPAVDEALTGAGTDTVRHVLVVRRTGQETAWTPGR
DIWWHEALESADTFHEPVWVDAEHPLFILYTSGTTGKPKGILHTTGGYLTQCAYTHRNVF
DLKDDDVYWCTADIGWVTGHSYVVYGPLTNGATQLLYEGTPDTPHRGRWWELIEKYGVSI
LYTAPTAIRTCMKWGEDIPSAFDLSSLRLLGSVGEPINPEAWIWYRRVIGGDTTPIVDTW
WQTETGAIMISPLPGVTAAKPGSAQVPLPGIAADVVDDEAKPVPDGGGGYLVLTEPWPSM
LRGIWGDRQRYEDTYWSRFRGLYFAGDGAKKDDDGDIWLLGRVDDVMNVSGHRLSTTEIE
SALVSHDIVAEAAVVGASDDMTGQAVVAFVILRGEHAGRAATPDGAEQVQAELRAHVAKE
IGPIAKPKRILVVAELPKTRSGKIMRRLLRDVAENRAVGDATTLADSSVMDLITAGLAAG
KSADD
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
ttgaccacgcaccctgaggccgcgagcctcgagaacctgctgcacgagacccggtcgttc
ccgccggcctccgccttcgcggcgcaggccaacgcgcagccctcgctctacgcggaggct
gccgccgaccgccctgagttctgggcccggcaggcccgcgagctcgtctcgtggcgcacc
ccgttcacccagaccctcgactggtccgacgcgccggtcgcgcgctggttcgccgacggc
accctcaacgccgcctacaacgccgtcgaccggcacgtcgaggccgggcacggcgaccgc
gtcgccatccacttcgagggcgagccgggcgacacccgcaccgtcacctacgcggacctg
cagcgcgaggtcgcacgggcggccaacgccctcgccgcgctcggcgtgagcaagggcgac
cgcgtcgtcatctacctgccgatgctggtcgagtccgtcgtcgccatgctggcgtgcgcg
cgcatcggcgccccgcactccgtggtgttcggcgggttctccgccgacgcgctgcgcagc
cgcatcgcggacgccgaggccacgctcgtgatcaccgccgacggcggctaccggcgcggg
gcggcgagcgcgctgaagcccgccgtcgacgaggcgctgacgggcgcgggcaccgacacg
gtcaggcacgtgctggtcgtgcgccgcacgggccaggagaccgcctggacgccgggccgc
gacatctggtggcacgaggccctggagtcggcggacaccttccacgagcccgtgtgggtg
gacgccgagcacccgctgttcatcctctacacctccggcaccaccgggaagccgaagggc
atcctgcacaccacgggcggctacctcacccagtgcgcctacacccaccggaacgtgttc
gacctcaaggacgacgacgtctactggtgcaccgccgacatcggctgggtgacgggccac
tcctacgtcgtctacggtccgctgaccaacggggccacacagctcctctacgagggcacc
ccggacaccccgcaccgcggccgctggtgggagctcatcgagaagtacggcgtctcgatc
ctctacaccgcccccaccgcgatccgcacgtgcatgaaatggggcgaggacatcccgtcg
gccttcgacctgtcctcgctgcgcctcctgggctcggtgggcgagcccatcaaccccgag
gcgtggatctggtaccgccgcgtcatcggcggggacaccacccccatcgtcgacacgtgg
tggcagacggagacgggcgcgatcatgatcagcccgctcccgggcgtcacggccgccaag
ccggggtccgcccaggtgccgctgccgggcatcgccgccgacgtcgtcgacgacgaggcc
aagcccgtgcccgacggcggtggcggctatctggtgctcaccgagccgtggccgtcgatg
ctgcgcggcatctggggcgaccggcagcgctacgaggacacctactggtcgcggttccgg
ggcctgtacttcgcgggcgacggcgccaagaaggacgacgacggcgacatctggctgctc
ggccgcgtcgacgacgtcatgaacgtctcggggcaccggctgtcgaccacggagatcgag
tcggcgctcgtctcgcacgacatcgtggccgaggccgccgtggtcggcgcctccgacgac
atgacgggacaggccgtggtcgcgttcgtgatcctgcgtggcgagcacgccggtcgcgcg
gcgacgcccgacggcgcggagcaggtccaggccgagctgcgggcccacgtggccaaggag
atcggcccgatcgccaagccgaagcgcatcctggtggtggccgagctccccaagacccgc
tcgggcaagatcatgcgccgcctgctgcgcgacgtcgccgagaaccgcgccgtcggcgac
gcgaccaccctggccgactcctccgtcatggacctgatcaccgccggcctcgcggcaggc
aagtccgcagacgactga

DBGET integrated database retrieval system