KEGG   Xylanimonas cellulosilytica: Xcel_0923Help
Entry
Xcel_0923         CDS       T01135                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00630  Glyoxylate and dicarboxylate metabolism
xce01100  Metabolic pathways
xce01110  Biosynthesis of secondary metabolites
xce01120  Microbial metabolism in diverse environments
xce01200  Carbon metabolism
Module
xce_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Xcel_0923
Enzymes [BR:xce01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Xcel_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACZ29954
UniProt: D1BYB1
Position
complement(992869..994197)
Genome map
AA seq 442 aa AA seqDB search
MTALTDRSASPTAPGVRAGDTVQTAAELAAAWATDPRWTDVERTYTADDVVALRGSVIEE
HTLARRGAELLWERLHTSEFVNALGALTGNQAVQQVKAGLRAIYLSGWQVAGDANAAGQT
YPDQSLYPANSVPQVVRRINNALLRADQVERLEGTRTVEDWLAPIVADAEAGFGGPLNAY
ELMRSMITAGAAGVHWEDQLASEKKCGHLGGKVLVPTQQHIRTLNAARLAADVEGVPTVV
VARTDAEAATLLTSDVDERDRPFLTGGRTAEGFYEVRPGLETSIARARAYAPYADLLWME
TGTPSLEVARAFAEGVRSEFPDQLLAYNCSPSFNWRRHLSEAEIATFQRELGAMGYAFQF
ITLAGFHALNHSMFDLAHGYAREQMTAYVRLQESEFASESRGYTATKHQREVGTGYFDRV
ATALNPTASTLALAGSTESAQF
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgctcaccgaccgctccgcctccccgaccgcccccggcgtccgtgccggcgac
acggtccagaccgccgccgagctcgccgccgcatgggcgaccgacccgcgctggaccgac
gtcgagcgcacgtacaccgccgacgacgtcgtcgccctgcgcggttcggtgatcgaggag
cacacgctcgcccgccgcggcgccgagctgctctgggagcggctgcacaccagcgagttc
gtcaacgcgctcggcgcgctcacggggaaccaggcggtgcagcaggtcaaggcgggcctg
cgggccatctacctgtccggctggcaggtcgccggcgacgccaacgcggccggccagacc
tacccggaccagtcgctgtacccggccaactccgtgccgcaggtggtgcggcgcatcaac
aacgcgctcctgcgcgccgatcaggtcgagcgcctcgagggcacccgcaccgtcgaggac
tggctcgcccctatcgtcgccgacgccgaggccgggttcggcggcccgctcaacgcctac
gagctcatgcgctcgatgatcaccgccggcgccgcaggcgtgcactgggaggaccagctc
gcctcggagaagaagtgcggccacctgggcggcaaggtgctggtgcccacgcagcagcac
atccgcacccttaacgccgcgcgtctggccgccgacgtcgagggcgtgcccaccgtcgtc
gtcgctcgcaccgacgccgaggcggccacgctgctgacctccgacgtcgacgaaagggac
cggccgttcctcaccggcggccgcaccgccgaggggttctacgaggtgcggcccggactc
gagacctcgatcgcccgcgcgcgggcctacgccccctacgccgacctgctgtggatggag
acggggacgccgtcgctcgaggtcgcgcgggccttcgccgagggcgtgcgcagcgagttc
ccggaccagctcctggcctacaactgctcgccgtcgttcaactggcgccgccacctctcg
gaagcggagatcgcgaccttccagcgcgagctcggggcgatgggctacgcgttccagttc
atcaccctggccgggttccacgccctcaaccactcgatgttcgacctcgcgcacgggtac
gcccgcgagcagatgaccgcctacgtgcggctccaggagtccgagttcgcctccgagagc
cgcggctacaccgccaccaagcaccagcgcgaggtcggcaccggctacttcgaccgggtc
gccaccgcgctcaaccccacggcctccaccctggccctcgccggctccaccgagtcggcc
cagttctga

DBGET integrated database retrieval system