KEGG   Xylanimonas cellulosilytica: Xcel_1302Help
Entry
Xcel_1302         CDS       T01135                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00340  Histidine metabolism
xce01100  Metabolic pathways
xce01110  Biosynthesis of secondary metabolites
xce01230  Biosynthesis of amino acids
Module
xce_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Xcel_1302
Enzymes [BR:xce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Xcel_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Peptidase_C21
Motif
Other DBs
NCBI-ProteinID: ACZ30333
UniProt: D1BR78
Position
1417132..1418457
Genome map
AA seq 441 aa AA seqDB search
MIQRIDLRGRTLTRRDLLAVLPRAEVGVDEALAAVTPIVADVRHRGAAALREIAERFDGV
RPDILRVPAEALAQALESLAAPVRAGLEEAIVRVRTVHTAQVPPEHVTELAPGAVVRQRY
VPVERVGLYAPGGLAVYPSSVIMNVVAAQAAGVAGIALASPPQKDHGGLPHPTILAACAL
LGVEEVYAVGGAQAVAMFAYGAVGSEPGDGETLCEPVDVITGPGNVYVAAAKRLVRGVVG
IDAEAGPTEIAVLADDTADAGHVALDLVSQAEHDPMAASVLVTPSEALASAVEERLVELT
SATKHSARVATALGGPQSAIVLVDDVEQGVQVVDAYGAEHLELQTADAAANADRIRNAGA
IFVGPWAPVSLGDYMAGSNHVLPTGGTARYASALSVLSFLKSVQVIEYTRDALADLADRI
VAVADDEDLPAHGEAVRGRFA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgatccagcgcatcgacctccgcggccgcacgctcacgcgccgcgacctgctcgccgtc
ctcccgcgtgccgaggtgggggtggacgaggccctcgccgccgtcacccccatcgtggcg
gacgtgcgacaccgcggcgccgcggccctgcgtgagatcgccgagcggttcgacggcgtg
cgccccgacatcctgcgggtgccagccgaggcgctcgcgcaggcgctggagagcctcgcg
gcgccggtgcgtgcgggtctcgaggaagccatcgtccgggtccgcacggtccacaccgcg
caggtcccgcccgagcacgtcaccgagctcgctcccggtgccgtggtgcggcagcggtat
gtccccgtcgagcgcgtgggcctgtacgccccgggcggtctggccgtgtacccgtcgagc
gtcatcatgaacgtcgtcgccgcgcaggccgcgggcgtcgcgggcatcgccctcgcatcg
ccgccgcagaaggaccacggcggcctgccgcaccccacgatcctcgcggcgtgcgcgctc
ctcggcgtcgaggaggtctacgccgtcggcggcgcgcaggccgtggcgatgttcgcctac
ggcgccgtgggcagcgaacctggcgacggcgagacgctctgcgagccggtcgacgtcatc
accggtccgggcaacgtctacgtcgccgccgccaagcggctcgtgcgtggcgtcgtcggc
atcgacgcggaggccgggcccaccgagatcgccgtgctcgccgacgacacggccgacgcg
gggcacgtcgccctcgacctggtcagccaggccgagcacgacccgatggccgcgtcggtg
ctggtcacgccgtcggaggcgctggcgagcgccgtcgaggagcgactcgtggagctcacg
tccgcgacgaagcactcggctcgcgtggccacggcgctcggcggcccgcagtcggcgatc
gtgctggtcgacgacgtcgagcagggcgtccaggtggtcgacgcgtacggcgccgagcac
ctggagctgcagacggccgacgccgcggcgaacgccgaccgcatccgcaacgccggggcg
atcttcgtcgggccgtgggcaccggtctccctcggcgactacatggcgggctccaaccac
gtgctcccgacgggcggcaccgcccggtacgcgagcgcactgagcgtgctgtcgttcctc
aagtcggtgcaggtcatcgagtacacgcgtgacgcgctcgcggacctcgcggaccggatc
gtggccgtggccgacgacgaggacctgccggcgcacggcgaggccgtccggggccgcttc
gcgtga

DBGET integrated database retrieval system