KEGG   Xylanimonas cellulosilytica: Xcel_2256Help
Entry
Xcel_2256         CDS       T01135                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00330  Arginine and proline metabolism
xce00332  Carbapenem biosynthesis
xce01100  Metabolic pathways
xce01130  Biosynthesis of antibiotics
xce01230  Biosynthesis of amino acids
Module
xce_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Xcel_2256
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Xcel_2256
Enzymes [BR:xce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Xcel_2256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACZ31274
UniProt: D1BV35
Position
complement(2436015..2437133)
Genome map
AA seq 372 aa AA seqDB search
MTSRSALPAARRVVVKIGSSSLTGPDGHLDVAALRALVEVLAARHAAGTQVVLVTSGAVA
AGIGPLGLATRPKDLATMQAAASVGQGLLVARYAEAFARYGIRVGQVLLTAEDTVRRLRY
RNAQRSLSRLLALGVVPVVNENDAVTTDELRFGDNDRLAALVSHLVRADALVLLTDVDGL
HDRSPSQPGAQRIPYVGDLAEVADVPVSSRGSAVGTGGMVTKLESVRIATASGITVVLAA
ARNAAAALVGDDVGTLFAATGRRTSARRLWIAHAARVRGRLHVDDGAARAVRGGRASLLP
AGITRVEGEFDAGDPVELVAPDGAVVARGLVAFDSAELPVLLGRQTAELREQLGEGYDRE
VVHRDDLVLNHR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcccgctccgccctgcccgccgcccgccgcgtcgtcgtcaagatcggttcctcg
tccctcaccgggccggacggacacctcgacgtcgccgcgctgcgagcgctggtcgaggtg
ctggccgcgcggcacgccgcgggcacccaggtggtgctcgtgacctccggtgcggtcgcg
gcggggatcggcccgctgggtcttgccacccggcccaaggacctcgccaccatgcaggcc
gcggcgtccgtcggccagggcctgctcgtggcccggtacgccgaggcgttcgcccggtac
ggcatccgcgtcggtcaggtgctcctcacggccgaggacacggtgcggcgtctgcgctac
cgcaacgcgcagcgctcgctctcgcgcctgctggcgctcggcgtcgtccccgtcgtcaac
gagaacgacgccgtcaccaccgacgagctgcggttcggcgacaacgaccgcctcgccgcc
ctcgtctcccacctcgtgcgcgccgacgcgctcgtgctgctcaccgacgtcgacgggctg
cacgaccggtcgccgtcgcaacccggggcgcagcgcatcccctacgtcggcgacctcgcc
gaggtcgccgacgtgcccgtcagcagccggggcagcgcggtcggcaccggtggcatggtc
accaagctcgagtccgtgcggatcgcgacggcgtcaggcatcaccgtggtgctcgccgcc
gcacgcaacgccgcggcggcgctcgtgggcgacgacgtcggcacgctgttcgccgcgacc
ggccgccgcacctcggcccgccggctgtggatcgcgcacgcggcacgggtgcgcggccgc
ctgcacgtcgacgacggtgcggcgcgtgcggtgcgcggcggccgggcctcgctgctgccg
gcgggcatcacccgtgtcgagggggagttcgacgccggcgacccggtcgagctggtcgcc
ccggacggcgccgtcgtcgcccgcggcctggtcgccttcgactccgccgagctgccggtg
ctgctggggcgccagaccgcggagctgcgcgagcagctcggggagggctacgaccgtgag
gtcgtccaccgtgacgacctggtgctgaaccaccggtga

DBGET integrated database retrieval system