KEGG   Xylanimonas cellulosilytica: Xcel_2972Help
Entry
Xcel_2972         CDS       T01135                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
xce  Xylanimonas cellulosilytica
Pathway
xce00010  Glycolysis / Gluconeogenesis
xce00260  Glycine, serine and threonine metabolism
xce00680  Methane metabolism
xce01100  Metabolic pathways
xce01110  Biosynthesis of secondary metabolites
xce01120  Microbial metabolism in diverse environments
xce01130  Biosynthesis of antibiotics
xce01200  Carbon metabolism
xce01230  Biosynthesis of amino acids
Module
xce_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Xcel_2972
  Energy metabolism
   00680 Methane metabolism
    Xcel_2972
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Xcel_2972
Enzymes [BR:xce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Xcel_2972
Membrane trafficking [BR:xce04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Xcel_2972
Exosome [BR:xce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Xcel_2972
  Exosomal proteins of melanoma cells
   Xcel_2972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACZ31978
UniProt: D1BZ81
Position
complement(3301599..3302342)
Genome map
AA seq 247 aa AA seqDB search
MGMTYTLVLLRHGESEWNAKNLFTGWVDVPLSEKGRGEATRGGELLKEAGVNPDVVHTSL
LRRAIMTANLALDSADRHWIPVKRSWRLNERHYGDLQGKDKKQVRDQYGDDQFMLWRRSY
DVPPPEIELGSEFSQDADVRYAGEPIPRAEALAQVLVRALPYWESEIVPDLKAGKTVLVA
AHGNSLRAIVKHLDGIDDATIAGLNIPTGIPLVYELDEDFTPVTPGGTYLDPAAAADAIA
AVANQGK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgacctacaccctcgtgctgctccgccatggcgagagcgagtggaacgccaag
aacctcttcaccggctgggtcgacgtgcccctgtccgagaagggccgcggggaggccacc
cgtggtggcgagctcctcaaggaggcgggcgtcaaccccgacgtcgtccacacgtcgctc
ctgcgccgcgccatcatgaccgccaacctggccctcgactccgccgaccggcactggatc
ccggtcaagcggtcgtggcgcctcaacgagcgtcactacggtgacctccagggcaaggac
aagaagcaggtccgcgaccagtacggcgacgaccagttcatgctgtggcgccgttcctac
gacgtgccgccgcccgagatcgagctcggctcggagttctcgcaggacgccgacgtgcgc
tacgccggggagccgatcccgcgcgccgaggcgctcgcgcaggtgctcgtccgggccctg
ccgtactgggagtccgagatcgtccccgacctcaaggcgggcaagacggtgctggtggcc
gcgcacggcaactcgctgcgcgccatcgtcaagcacctcgacggcatcgacgacgcgacc
atcgcgggcctcaacatccccacgggcatcccgctggtctacgagctggacgaggacttc
acgccggtcacgcccggcggcacctacctcgaccccgccgccgcggccgacgcgatcgcc
gcggtcgccaaccagggcaagtag

DBGET integrated database retrieval system