KEGG   Xanthomonas citri pv. citri mf20: J172_00321Help
Entry
J172_00321        CDS       T03781                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xcf  Xanthomonas citri pv. citri mf20
Pathway
xcf00071  Fatty acid degradation
xcf00072  Synthesis and degradation of ketone bodies
xcf00280  Valine, leucine and isoleucine degradation
xcf00310  Lysine degradation
xcf00362  Benzoate degradation
xcf00380  Tryptophan metabolism
xcf00620  Pyruvate metabolism
xcf00630  Glyoxylate and dicarboxylate metabolism
xcf00640  Propanoate metabolism
xcf00650  Butanoate metabolism
xcf00900  Terpenoid backbone biosynthesis
xcf01100  Metabolic pathways
xcf01110  Biosynthesis of secondary metabolites
xcf01120  Microbial metabolism in diverse environments
xcf01130  Biosynthesis of antibiotics
xcf01200  Carbon metabolism
xcf01212  Fatty acid metabolism
xcf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    J172_00321
   00630 Glyoxylate and dicarboxylate metabolism
    J172_00321
   00640 Propanoate metabolism
    J172_00321
   00650 Butanoate metabolism
    J172_00321
  09103 Lipid metabolism
   00071 Fatty acid degradation
    J172_00321
   00072 Synthesis and degradation of ketone bodies
    J172_00321
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    J172_00321
   00310 Lysine degradation
    J172_00321
   00380 Tryptophan metabolism
    J172_00321
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    J172_00321
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    J172_00321
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J172_00321
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xcf04147]
    J172_00321
Enzymes [BR:xcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     J172_00321
Exosome [BR:xcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   J172_00321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJZ06923
Position
260727..262007
Genome map
AA seq 426 aa AA seqDB search
MPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFGLHGQQLGEVAMGAVI
KHSADWNLAREAALSSGLSPLTPGITLQRACGTSLDSVITIANKIALGQIDSGIGGGSDT
TSEVPIVYGKKLRARLLAANRAKATGDKLRALLRGFKLAELKPEFPGVAEPRTGKSMGDH
CEDMAKEWNISRDSQDEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADTSLEKL
ATLRPAFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQVAAVDF
VHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCRNRLGL
DAPLGRIDPDKINPLGSSLATGHPFAATGARVVATAAKQLEERGGGRALISICTAGGMGV
VAIVER
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcagcccgtcccgtcgccattctgggcggcgttcgtatcccgttctgtcgtcag
aacaccgcctacgcggacgtgggcaacctgggcatgtcggtgcgcacgctgggcgcgttg
gtcgagcgcttcgggttgcatgggcagcaattgggcgaagtggcgatgggcgcggtgatc
aagcactccgcggactggaacctggcgcgcgaggcggcgctgtcgtcgggtctgtcgccg
ctgacgccgggcatcaccctgcagcgcgcctgcggcaccagcctggattcggtcatcacc
atcgccaacaagatcgcgctggggcagatcgactcgggcatcggcggcggctccgacacc
acctccgaagtgccgatcgtgtacggcaagaagttgcgcgcacggctgctggccgccaac
cgcgccaaggccaccggcgacaagctcagggcgctgctgcgcggcttcaagctggccgag
ctcaagcccgaattccccggcgtggccgagccgcgcaccggcaagagcatgggcgaccat
tgcgaggacatggccaaggaatggaacatctcgcgcgattcgcaggacgaatgggcggtg
gcctcgcaccacaagctggccgctgcctatgagcgcggtttcttcgacgcgctgatcgcg
ccgttccgcggcgtctcgcgcgacaacatcctgcgcgccgacacctcgctggaaaaactc
gcgaccttgcgaccggccttcgacaagacctccggccgtggcacgttgaccgctgccaat
tccaccccgctcaccgatggcgccgccgcggtgctgctctccagcgaagcctgggcgttg
gcgcatggccacacgccgatggcctacctgcgcgatgcacaggtggcggcagtcgacttc
gtgcatggcgaaggcctgctgatggcgcccaccattgcggtgccgcagatgctggcgcgc
cagggcctgaccctgcaggacttcgatatctacgaaatccacgaggccttcgccgcgcag
gtgctgtgcacgctgcgcgcgtgggagagcgaggactactgccgcaaccggctgggcctg
gacgcgccgctgggccgcatcgacccggacaagatcaatccgctgggctcgtcgctggcc
accggccatccattcgccgccactggcgcacgcgtggtggccaccgctgccaagcagttg
gaagagcgcggcggcggccgcgcgttgatttcgatctgcaccgccggcggcatgggcgtg
gtggccatcgtcgagcgctga

DBGET integrated database retrieval system