KEGG   Xanthomonas citri pv. citri mf20: J172_00591Help
Entry
J172_00591        CDS       T03781                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
xcf  Xanthomonas citri pv. citri mf20
Pathway
xcf00260  Glycine, serine and threonine metabolism
xcf01100  Metabolic pathways
xcf01110  Biosynthesis of secondary metabolites
xcf01120  Microbial metabolism in diverse environments
xcf01130  Biosynthesis of antibiotics
xcf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    J172_00591
Enzymes [BR:xcf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     J172_00591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJZ07192
UniProt: A0A0U5BZ16
Position
567778..568839
Genome map
AA seq 353 aa AA seqDB search
MDGQGSATRISFRNDYSEGAHPRLLQALAQASAEQHAGYGTDRHTARAVALIRTAVAQPQ
ADVHLLVGGTQTNLIAISAFLRPHQAVIAVDAAHIATHETGAIEATGHKVLTVPALHDKL
TPALIQPVLAVHSNEHMVQPRLVYISNSTESGTIYTRAELDALSRFCRANDLLLYLDGAR
LGAALTADGNDLDLPAIATLTDAFYIGGTKNGALLGEALVIVNPALQADLRYLIKQRGAL
LAKGMVVGAQFAALFEDSLFFELAAHANAMAQRLRAGLLAAGAHFTSDSPTNQQFIAVSA
QHAAQLVQRYDFERWEVRTDGSQVIRFVTSWATTAASVDRLCADVAALHRGVS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacgggcagggtagcgctacgcgcatcagctttcgcaacgactacagcgaaggcgcg
catccgcggctgttgcaggcgttggcgcaggccagcgccgagcagcatgccggctatggc
accgatcggcacacagcgcgtgcggttgcgttgatccgcaccgcagtcgcgcagccgcag
gccgacgtgcatctgctggtcggcggcacgcagaccaatctgattgcgatcagcgcgttc
ttgcgcccgcatcaggcagtcatcgcggtggacgcggcgcatatcgccacgcacgagacc
ggcgccatcgaagcgaccggccacaaggtgctcaccgtgccggcgctgcacgacaagctg
acgcctgcgctgattcagccggtgctggctgtgcacagcaacgaacacatggtgcagccg
cgtctggtctacatttccaacagcaccgaaagcggcaccatctatacgcgcgccgaactc
gatgcgttgtcgcggttttgtcgcgcgaacgatttgctgctgtacctggatggcgcgcgt
ctgggtgcggcgctgaccgccgacggcaacgatctggatctgccggccattgccacgctg
accgacgcgttctatatcggtggcaccaagaatggtgcgctgctcggcgaagcgctggtc
atcgtcaatcccgccctgcaggcggatttgcgttatctgatcaagcagcgcggcgcgcta
ctggccaagggcatggtggttggtgcgcaatttgcggcgttgttcgaagacagtctgttc
ttcgaactggccgcgcatgccaatgccatggcgcaacgcttgcgcgccggcctgcttgcg
gccggcgcgcacttcaccagcgactcgccgaccaaccagcagttcatcgccgtcagcgcg
caacacgctgcgcagctcgtgcaacgctacgacttcgagcgctgggaagtgcgcaccgat
ggcagtcaggtaatccgcttcgtgacctcgtgggcgaccacagccgcgtcggtcgatcgg
ctgtgtgcggatgttgccgcacttcatcgcggcgtgtcgtaa

DBGET integrated database retrieval system