KEGG   Xanthomonas citri pv. citri mf20: J172_00907Help
Entry
J172_00907        CDS       T03781                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase (NAD(P))
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
xcf  Xanthomonas citri pv. citri mf20
Pathway
xcf00670  One carbon pool by folate
xcf01100  Metabolic pathways
xcf01120  Microbial metabolism in diverse environments
xcf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    J172_00907
Enzymes [BR:xcf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     J172_00907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AJZ07504
UniProt: A0A0U5F8U5
Position
complement(938919..939746)
Genome map
AA seq 275 aa AA seqDB search
MTHLSFEFYPPKTDDQRAQLDRTAARLKGYAPEYVSCTFGAGGSTLSYTSETVRHLKQKH
GFEAAPHLSCVGGSRQEIRELLKLYRAIGCTRIVALRGDLPSGMGHPGDLRYASDLIAFI
RAEHGDAFRIEVGAYPETHPQAADALSDLRYFKAKVDAGADAAITQYFYNADAYFHFRDA
VQRMGVEIPIIPGIMPISNFSQLRRFSEQCGAEIPRWIGKKMQSYGDDADAVRAFGAEVV
AALCERLIAGGAPALHFYTLNLAKPTTQVLQLLGR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatctcagtttcgagttctatccgcccaagaccgatgatcagcgcgcgcaactg
gaccgcactgcagccaggttgaagggctacgcgccggagtacgtgtcgtgcaccttcggc
gccggcggctccacgctcagctacacctccgaaacggtgcgccacctcaagcagaagcat
ggcttcgaagcggcgccgcatctgtcctgcgtcggcggcagccggcaggagatccgcgag
ctgctcaagctgtatcgcgccatcggctgcacccgcatcgtcgcgctacgtggcgacctg
ccctcgggcatgggccatccgggcgacctgcgttacgcctcggacctgatcgccttcatc
cgcgccgaacacggcgacgcattccggatcgaggtcggcgcctatccggaaacccatccg
caggcggccgacgcgctcagcgacctgcgctatttcaaggccaaggtcgatgccggcgcc
gatgcggccatcacccagtatttctacaacgccgatgcctactttcatttccgcgacgca
gtgcagcggatgggcgtggagataccgatcattcccggcatcatgccgatctccaatttc
tcgcagctgcggcggttttccgagcagtgcggcgcagagattccacgctggatcggcaag
aagatgcagtcctacggcgacgacgccgacgcggtgcgcgccttcggcgcagaggtcgtg
gcggccttgtgcgagcgcctgatcgcaggcggcgcgccggcactgcacttctacaccctc
aatctggccaagccgaccacgcaggtgttgcagctgctcggacgctga

DBGET integrated database retrieval system