KEGG   Xanthomonas citri pv. citri mf20: J172_00980Help
Entry
J172_00980        CDS       T03781                                 

Definition
(GenBank) Uncharacterized protein affecting Mg2+/Co2+ transport
  KO
K06195  ApaG protein
Organism
xcf  Xanthomonas citri pv. citri mf20
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    J172_00980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AJZ07576
UniProt: A0A0U5FAF0
Structure
PDB: 

Position
complement(1023872..1024255)
Genome map
AA seq 127 aa AA seqDB search
MQDDPRYRVEVEVSPRFLAHQSTPDEGRYAFAYSIRIQNAGAVPARLVARHWQITDGNGR
TEQVDGEGVVGEQPWLRPGEAFHYTSGVLLETEQGQMQGHYDMVADDGTEFIAPIAAFVL
SVPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgatccgcgctaccgggtcgaggtcgaggtatcgccccgcttcctcgcccat
caatccaccccggacgaaggccgctatgcctttgcctacagcatccgcatccagaatgcg
ggcgcggtgcctgcgcgcctggtcgcgcgccattggcagatcaccgatggcaacggacgc
accgagcaggtggatggcgaaggggtggtcggcgaacagccgtggctgcgcccgggcgaa
gcgttccattacacctctggcgtactgctggagaccgagcagggacagatgcaaggccac
tacgacatggtggccgacgatggcaccgaatttatcgccccgatcgccgccttcgtgctg
agcgtgcccaggacgctgcactga

DBGET integrated database retrieval system