KEGG   Xanthomonas citri pv. citri mf20: J172_04334Help
Entry
J172_04334        CDS       T03781                                 

Definition
(GenBank) Phosphodiesterase/alkaline phosphatase D
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
xcf  Xanthomonas citri pv. citri mf20
Pathway
xcf00790  Folate biosynthesis
xcf01100  Metabolic pathways
xcf02020  Two-component system
Module
xcf_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xcf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    J172_04334
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    J172_04334
Enzymes [BR:xcf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     J172_04334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: AJZ10860
UniProt: A0A0U5FS85
Position
4899530..4901158
Genome map
AA seq 542 aa AA seqDB search
MPVIDPPAASPLPDCAATLVPPDPSRRRILIAGASLAAAGLLSPFARASGSADPFTLGVA
AGDPLADGFVIWTRLAPRPLDPDGRGGLRAAVPVRWQVASDPQMRTIVRQGETIASPVWG
HAVHVELTGLMADRPYWYCFQALGARSPIGSARTLPAAHQTPDAARFGFVSCSHWELGYF
SAYRHLAAEQPDLVFFLGDYIYEYSNHGEATNKIVRPHGSGECLDLAGYRNRYALYRTDP
DLQALHAGSACAATWDDHEVQNDYANRWSQDPSIPVDTFLARRAAAYRAFYEHFPLRARH
RPHGADMRIYRSFDYGQLARFYVLDGRQYRSEQPCPQANGWRGGHVVADSCRERTDPRRT
MLGWEQERWLHGGFAQSPARWNVIAQDLLVAPMRQAGRDGVVGHWTDGWDGYPATRERML
DAIAKTRLRNPVFWGGDIHSYWVTDLKADPADDASATLATEFVGTSITSDGQSNDELHAT
MAANPHVHYVDGQTRGYVSVTLTPGRMETRLQGISDRRDRNATVSTTKRFVVEDGRPGAV
EA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgatcgacccgcctgccgcctcacccctgcctgattgcgctgccacgcttgtg
ccaccggatccgagccggcggcgcatcctcatcgccggcgccagcctggctgcggcgggg
ctgctgagcccgttcgcacgcgccagcggcagtgccgatcccttcacgctgggcgtggcg
gccggcgacccgttggccgatggctttgtgatctggacgcggctggcaccccgcccgctg
gacccggacggacgcggcggcctgcgcgcggcggtgccggtgcgctggcaggtggccagc
gacccgcagatgcgcaccatcgtgcgccagggcgagaccatcgccagccccgtctggggc
cacgcagtgcacgtggagctcaccggtttgatggccgatcgcccctactggtactgcttt
caggccctgggtgcacgcagcccgatcggcagcgcgcgcaccctgccggcagcgcatcag
acgccggacgcagcgcggttcgggtttgtttcctgctcgcactgggaactggggtatttc
agcgcctaccgccacctcgccgccgagcagccggacctggtgttcttcctgggcgattac
atctacgagtacagcaaccacggcgaggcgacgaacaagatcgtgcgcccgcacggcagc
ggcgaatgcctggatctggccggctaccgcaatcgctatgcgctgtaccgcaccgacccg
gacctgcaggcgctgcatgccggcagcgcctgcgcggcgacctgggacgatcacgaggta
cagaacgattacgccaatcgctggtcgcaggacccgtcgattccggtcgatacctttctg
gcccggcgcgctgccgcctaccgcgccttctacgaacatttcccgctgcgtgcgcggcat
cgcccgcacggcgcggacatgcgcatctaccgctcgttcgattacggccagctggcgcgt
ttctacgtgctcgatggccgccagtaccgcagcgagcaaccctgcccgcaggccaatggc
tggcgcggcggccatgtggtggccgacagttgccgcgagcgcaccgacccgcggcgcacc
atgctcggctgggaacaggagcgctggctgcatggcggcttcgcgcagtcgcccgcccgc
tggaacgtgattgcgcaggatctgctggtggcaccgatgcgacaggcggggcgcgacggc
gtggtcgggcactggaccgacggttgggacggctacccggccacgcgcgaacgcatgctc
gatgcgattgcaaagacgcgcctgcgcaacccggtgttctggggcggcgacatccactcg
tactgggtcaccgacctgaaggccgatccggccgacgacgcgtcggcaacgctggccacc
gaattcgtcggcacttcgatcacctccgacggccagagcaacgacgaactgcatgcgacc
atggcagccaacccgcacgtgcattacgtggacgggcaaacgcgcggctatgtgtcggtg
acgctcacgccgggccggatggaaacgcggctgcagggcatctccgatcggcgcgaccgc
aacgccacggtgtcgaccaccaagcgcttcgtggtggaggacggcaggcccggcgcagtg
gaggcgtga

DBGET integrated database retrieval system