KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00177Help
Entry
XCAW_00177        CDS       T02519                                 

Definition
(GenBank) FHA-domain-containing protein
  KO
K11894  type VI secretion system protein ImpI
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Brite
KEGG Orthology (KO) [BR:xci00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:xci02044]
    XCAW_00177
Secretion system [BR:xci02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   XCAW_00177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA Yop-YscD_cpl
Motif
Other DBs
NCBI-ProteinID: AGI06004
Position
223056..224372
Genome map
AA seq 438 aa AA seqDB search
MSSSQLILTVGGAQAAQFGASAQKRFAGTGGSIGRSDESDWVLAAPGVSRTHAVVRFLNG
MYFIEDRSTNGMSLNGTALTRADPSALSDGDRLQLDSFEIHVQVQSLAAAPTPAPAFDPL
PDAMDDRTQVAPPPSTRRAPSATACLDLLEFGTPPSARPAVDALLDDLLLSGAPGELDPL
RLLDPSPAPARDASPSAWNQSNASHDHFRPPASPDARATLPENWDMTLGDFAPPAPLPAL
APMAAPVASPFAPPAAVSVATAPSAATTVPPELDRIFAIVVDGVMDVLRARAEIKNTFRL
PVTVIQRSENNPLKFAATAEDALQKLLAPPSASFLSGVPAFEDAFDDIRCHQMAMLAGMR
AAFDAMLFHFSPDRLEQEADAGGKRLGFGGKGRYWERYRDNFEQLRSDPDDCFRRLFGDE
FARAYEAQLARLKSARRH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagttcgcagttgatcctcaccgtcggcggcgcgcaggccgcgcagttcggcgcc
agcgcgcagaagcgctttgccggcaccggcggcagcatcggccgctccgacgaaagcgat
tgggtcctggccgcgcccggtgtctcgcgcacgcatgcggtggtgcgctttctcaacggg
atgtatttcatcgaggaccgcagcaccaacggcatgtcgctcaacggcactgcgctgacg
cgtgcggacccgtccgcgctcagcgatggcgaccgcctgcagctggacagcttcgagatc
catgtgcaggtgcaatcgctggctgcagccccgacgccggcgccggcattcgacccgctg
ccagatgcgatggacgaccgcacccaggttgcgccgccgccgtcgacgcggcgtgccccc
tccgccacagcgtgcctggatctgctggagttcggtacgccgccttctgcgcggcctgca
gtggacgcgttgttggacgatctgctgctgagcggcgcacccggcgagctggatccgttg
cgcctgctcgacccgtcgcctgcaccggcacgcgatgccagccccagcgcgtggaatcag
agcaacgccagccacgaccatttccgtccaccggccagtcccgatgcgcgcgccaccttg
ccggaaaactgggacatgacgcttggcgattttgcgccgcccgcgccattgcctgcgtta
gcgcccatggccgcgccggtggcctcgccattcgcgccgccggcggcggtgtcggttgca
accgcaccatcggcggcaacaacagtgccgccggagctggatcgcatcttcgccatcgtg
gtcgatggcgtcatggatgtgctgcgtgcacgcgcagagatcaagaacacctttcgcttg
ccggtcacggtgatccaacgctcggagaacaacccgctcaagttcgccgccaccgccgaa
gatgcgctgcagaagttgctcgcaccgccaagcgcgtcgtttctgtccggggtgccagcg
ttcgaagatgccttcgacgatatccgctgccatcagatggcgatgctggccggcatgcgc
gcggccttcgacgccatgctgttccacttcagcccggaccgcctggagcaggaagccgac
gccggcggtaagcgcctgggtttcggtggcaaggggcgttactgggaacgctaccgcgac
aatttcgagcagctgcgcagcgacccggacgactgcttccgtcgcctgttcggcgatgag
ttcgcgcgtgcctacgaggcgcaactggcgcgcttgaaatcggcacggcggcattga

DBGET integrated database retrieval system