KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_00613Help
Entry
XCAW_00613        CDS       T02519                                 

Gene name
hemD
Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
xci00860  Porphyrin and chlorophyll metabolism
xci01100  Metabolic pathways
xci01110  Biosynthesis of secondary metabolites
xci01120  Microbial metabolism in diverse environments
Module
xci_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:xci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XCAW_00613 (hemD)
Enzymes [BR:xci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     XCAW_00613 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Tom5
Motif
Other DBs
NCBI-ProteinID: AGI06432
Position
complement(727384..728163)
Genome map
AA seq 259 aa AA seqDB search
MTGLAHSDAAWTLISLRPSGEHAPLRRAVARHGGRVLALSPWRLQTHDTAQARDALRQAL
AAPIAIFTSPAAVQAAHRLAPLQRPAQAHWVSVGDGTARALHACGIDTVVRPARMDSEGL
LALPLLQAPLQAVGLITAPGGRGMLAPTLQQRGARIVRADVYQRVPLRLRASAIQALSLA
LPRSVLALSSAEALTLVLQQLPAELVAAWQQRPVVASSDRMLDAAHAAGFAHGMRAEGPL
PLQLAAAAEAAIMTPPRPC
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccttgcccattccgatgctgcctggaccctgatctcgctgcgccccagcggt
gaacatgcgccgctacggcgggcagttgcgcggcatggcggacgggtactagcgctgtcg
ccatggcgcttgcagacccatgacaccgcacaagcgcgagacgcgctgcggcaggcgctg
gcagcaccgattgcgattttcaccagcccggcggcagtgcaggcggcgcatcgtctggcg
ccgctgcagcgcccggcgcaggcgcactgggtcagcgtgggcgacggcactgcgcgcgca
ttgcacgcctgcggcatcgacaccgtggtgcggccggcgcgcatggacagcgaaggcctg
cttgcgctgccgttgctgcaggcgccgctacaggccgtcgggctgatcactgcccccggc
ggacgcggcatgctggcgccaacgctgcagcagcgcggtgcgcgcatcgtgcgtgccgat
gtctatcaacgcgtcccgctgcgcttgcgcgcctcggccatccaggcgttgtcgcttgca
ctgccgcgcagcgtgctggcgctcagtagcgccgaagcgctgacgctggttctgcaacag
ctgcctgccgaactggtcgctgcgtggcaacagcgtccggtcgtggcatccagcgatcgt
atgctcgacgccgcacatgccgccggcttcgcgcatggcatgcgcgcagaaggcccgttg
ccgctgcagctcgccgctgctgctgaggcggcgatcatgacaccaccgcgaccttgctga

DBGET integrated database retrieval system