KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_01809Help
Entry
XCAW_01809        CDS       T02519                                 

Gene name
ndk
Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
xci00230  Purine metabolism
xci00240  Pyrimidine metabolism
xci01100  Metabolic pathways
xci01110  Biosynthesis of secondary metabolites
xci01130  Biosynthesis of antibiotics
Module
xci_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
xci_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
xci_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:xci00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    XCAW_01809 (ndk)
   00240 Pyrimidine metabolism
    XCAW_01809 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xci04131]
    XCAW_01809 (ndk)
Enzymes [BR:xci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     XCAW_01809 (ndk)
Membrane trafficking [BR:xci04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    XCAW_01809 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AGI07600
Position
complement(2009966..2010391)
Genome map
AA seq 141 aa AA seqDB search
MALERTLSIIKPDAVAKNVIGEIYSRFEKAGLKVVAAKYKQLSRREAEGFYAVHRERPFF
NALVEFMISGPVMIQALEGENAVAAHRDLLGATNPKDAAPGTIRADFADSIDANAAHGSD
SVENAANEVAYFFAATEVVSR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggagcgcaccctgtccatcatcaagcccgacgccgttgccaagaacgtcatc
ggcgaaatctacagccgcttcgaaaaggctggcctgaaggtcgtggccgccaagtacaag
cagctgtcgcgtcgtgaagccgaaggcttctacgccgttcatcgcgagcgtccgttcttc
aacgcgctggtcgagttcatgatttccggcccggtgatgatccaggcgctggaaggcgag
aacgccgtcgccgcacaccgtgacctgctgggcgcgaccaatcccaaggacgctgcgccg
ggcaccatccgcgccgacttcgccgattcgatcgatgccaatgctgcccacggctcggat
tcggtcgagaacgctgccaacgaagtcgcgtatttctttgccgccaccgaagtggtctcg
cgctga

DBGET integrated database retrieval system