KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_01997Help
Entry
XCAW_01997        CDS       T02519                                 

Gene name
mET2
Definition
(GenBank) Homoserine acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
xci00270  Cysteine and methionine metabolism
xci00920  Sulfur metabolism
xci01100  Metabolic pathways
xci01110  Biosynthesis of secondary metabolites
xci01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xci00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    XCAW_01997 (mET2)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XCAW_01997 (mET2)
Enzymes [BR:xci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     XCAW_01997 (mET2)
    2.3.1.46  homoserine O-succinyltransferase
     XCAW_01997 (mET2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase DUF3048
Motif
Other DBs
NCBI-ProteinID: AGI07788
Position
2205334..2206536
Genome map
AA seq 400 aa AA seqDB search
MTEFIPAGTLYHALPSPFPMKRGGVLHQARVAYETWGTLAADRSNAILIVTGLSPNAHAA
ANQANPEPGWWEAMLGPGKPIDTARWFVVCVNSLGSCKGSTGPASVNPDTGAPYRLSFPD
LSIEDVADAAADVVHALGIAQLACLIGNSMGGMTALALLLRHPGIARSHINISGSAQALP
FSIAIRSLQREAIRLDPHWNGGHYDDVRYPESGMRMARKLGVITYRSALEWDGRFGRVRL
DSEQAADDPFGLEFQVESYLEGHARRFVRFFDPNCYLYLSRSMDWFDLAEYVEERPVAGS
AIDNARADARPASAKPQTGVSTADTVLAGLARIRIARALAIGANTDILFPVQQQEQIADG
LRAGGADAQFIGLDSPQGHDAFLVDFARFGPAVSDFLQDC
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattcatccctgccggcacgctgtaccacgccctgccctcgccatttccgatg
aaacgcggtggcgtgctgcatcaggcacgcgtggcgtacgagacctggggcacgctggcc
gcagatcgcagcaacgcgatcctgatcgtcaccggcctgtcgcccaatgcgcacgcagcg
gcaaaccaggccaaccccgagccgggctggtgggaagcaatgctagggccgggcaagccg
atcgataccgcacgctggttcgtggtctgcgtcaattcgttaggcagttgcaagggctcg
accgggccggcctcggtaaacccagacaccggcgcgccgtatcgcctcagctttccggac
ctgtcgatcgaagacgtggccgatgccgcagccgacgtggttcacgcgttgggcatcgcg
cagctggcttgcctgatcggcaactcgatgggcggcatgaccgcgctggcgctgttgctg
cgccatcccggcatcgcgcgcagccatatcaatatttccggcagcgcgcaggcattgccg
ttttcgatcgcgatacgctcgttgcaacgcgaggcgatccggctggatccacactggaac
ggcggccactacgacgatgtgcgctacccggaatcgggcatgcgcatggcgcgcaaactc
ggcgtgatcacgtatcgttcggcgctggaatgggacggccgtttcggccgcgtgcggctg
gattccgagcaggcagccgatgatccgttcgggctcgaattccaggtggaaagctatctg
gaaggccacgcgcgccgcttcgtgcgttttttcgacccaaactgctatctgtatctgagc
cgctcgatggactggttcgacctggccgagtatgtcgaggaaagaccggttgccggctct
gccatcgacaatgcccgtgcagatgcacggcccgcttccgccaagccacagaccggcgtc
tcgaccgccgacaccgtgcttgccggcctggcacgtatccgcatcgcgcgtgcgctggcg
atcggcgccaacaccgacatcctgttcccggtgcagcagcaggaacagatcgccgacggc
ctgcgcgccggcggcgccgatgcgcaattcatcggcctggattcgccgcaaggccacgac
gcgttcctggtcgatttcgcccggttcggcccagcggtgagcgactttttgcaggactgt
tga

DBGET integrated database retrieval system