KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_02886Help
Entry
XCAW_02886        CDS       T02519                                 

Gene name
btuE
Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
xci00480  Glutathione metabolism
xci00590  Arachidonic acid metabolism
xci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xci00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    XCAW_02886 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XCAW_02886 (btuE)
Enzymes [BR:xci01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XCAW_02886 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AGI08663
Position
complement(3214813..3215298)
Genome map
AA seq 161 aa AA seqDB search
MSDISTFAFTDLEGRTQSMRDYAGNVLLVVNVASKCGFTPQYAGLQALWQRYRERGLVVI
GFPCDQFGHQEPGDAAQIRQFCSLDYAVDFPLAAKIDVNGNGAHPLWQWLKHEQRGVLGS
EAIKWNFTKFLIGRDGRVLERYAPTTKPEALATEIERALDA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatctccaccttcgcattcaccgacctggaaggtcgcacccagtcgatgcgc
gattatgccggcaacgtactgctggtggtcaatgtcgcctccaagtgcgggtttacgccg
caatacgcggggctgcaggccctgtggcagcgttatcgcgaacgtggactggtagtgatc
ggttttccatgcgatcagttcgggcaccaggagccgggcgatgcggcgcagatccgccag
ttctgctcgctcgactatgcggtggattttccgctggccgcgaaaatcgacgtcaacggc
aacggcgcgcatccgctgtggcaatggctcaagcacgaacaacgcggcgtgctcgggtcc
gaggcgatcaagtggaacttcaccaagttcctgatcggccgcgacggccgcgtgctggaa
cgttatgcgcccaccaccaagccggaggcattggctaccgagatcgagcgcgcgctggac
gcatga

DBGET integrated database retrieval system