KEGG   Xanthomonas citri subsp. citri Aw12879: XCAW_02998Help
Entry
XCAW_02998        CDS       T02519                                 

Gene name
paaJ
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
xci  Xanthomonas citri subsp. citri Aw12879
Pathway
xci00071  Fatty acid degradation
xci00072  Synthesis and degradation of ketone bodies
xci00280  Valine, leucine and isoleucine degradation
xci00310  Lysine degradation
xci00362  Benzoate degradation
xci00380  Tryptophan metabolism
xci00620  Pyruvate metabolism
xci00630  Glyoxylate and dicarboxylate metabolism
xci00640  Propanoate metabolism
xci00650  Butanoate metabolism
xci00900  Terpenoid backbone biosynthesis
xci01100  Metabolic pathways
xci01110  Biosynthesis of secondary metabolites
xci01120  Microbial metabolism in diverse environments
xci01130  Biosynthesis of antibiotics
xci01200  Carbon metabolism
xci01212  Fatty acid metabolism
xci02020  Two-component system
Brite
KEGG Orthology (KO) [BR:xci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    XCAW_02998 (paaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    XCAW_02998 (paaJ)
   00640 Propanoate metabolism
    XCAW_02998 (paaJ)
   00650 Butanoate metabolism
    XCAW_02998 (paaJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    XCAW_02998 (paaJ)
   00072 Synthesis and degradation of ketone bodies
    XCAW_02998 (paaJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XCAW_02998 (paaJ)
   00310 Lysine degradation
    XCAW_02998 (paaJ)
   00380 Tryptophan metabolism
    XCAW_02998 (paaJ)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XCAW_02998 (paaJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    XCAW_02998 (paaJ)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XCAW_02998 (paaJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xci04147]
    XCAW_02998 (paaJ)
Enzymes [BR:xci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     XCAW_02998 (paaJ)
Exosome [BR:xci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XCAW_02998 (paaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGI08774
Position
3342685..3343860
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAAKRTAIGSFLGQFNAVPAPTLAAAAIQGALAQSGIAPADISEVIVGCVLPAN
LGQAPARQAAIAAGIPTSTGATTINKVCGSGMKAIMLGHDLIKAGSASIVVAGGMESMSN
APHLLPNSRTGNRYGNFQAVDHMAWDGLTNPYDGQAMGVFGEATAEKFGFSRADQDAFAI
ASVERAHAAQRSGAFADEIVPVTVATRKGDVVVDSDEQPGKSDVAKIPTLKPAFKKDGSV
TAASSSSISDGAAITVLMSADDAQRRGVTPLARIVGHVTHAQEPEWFTTAPVAAIQSLVS
KLGWRLDDVDLFEINEAFAVVAMAPIRQLGIAHDKVNVHGGACALGHPIGASGARLVVTL
VNALRSRGGKRGIATLCIGGGEATAIAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcgtcatcgttgctgccaaacgtactgccatcggctcgttcctcggccaa
ttcaatgcggtgccggcacccacgctcgccgcggctgctatccagggcgcactcgcgcaa
tcaggcatcgcgcctgccgatatttccgaagtcatcgtcggctgcgtgctgccggccaat
ctgggccaggcacctgcgcgtcaggccgcgatcgccgcaggcattcctacctcgaccggc
gccaccaccatcaacaaggtgtgcggctcgggaatgaaggcgatcatgttggggcacgac
ctgatcaaggccggctcggccagcatcgtggtggccggcggcatggagtcgatgagcaat
gccccgcatctgctgcccaactcgcgcaccggcaaccgctacggcaattttcaggcggtc
gatcacatggcctgggacggtctgaccaatccgtatgacggccaggccatgggcgtgttc
ggcgaagccactgcggagaagttcggcttcagccgcgccgaccaggatgcgttcgccatc
gcctcggtggaacgcgcgcacgcggcgcagcgcagcggcgcgtttgccgacgaaatcgtg
ccggtgacggtggccacgcgcaagggcgacgtcgtcgtcgacagcgatgagcagccgggc
aagtccgacgtggccaagattccgacgctgaagccagccttcaagaaagacggcagcgtg
accgcggccagttcctcgagtatttccgatggcgcggcaatcaccgtgctaatgagcgcg
gacgacgcgcaacgccgtggcgtgacgccgctggcacgcatcgttggccatgtcacccac
gctcaggaaccggagtggttcaccaccgcaccggtcgctgcgatccagtcgctggtcagc
aagctcggctggcgattggacgatgtggatctgttcgaaatcaacgaagccttcgccgtc
gtggcgatggcaccgatcaggcaactcggcatcgcgcacgataaggtcaatgtgcatggc
ggcgcctgcgcattgggtcatccgatcggtgcatccggcgcgcgtttggtggtgacattg
gtgaacgcgttgcgcagccgcggaggcaagcgcggaatcgccacgctgtgcatcggcggc
ggcgaagccactgccattgctatcgaattgatttaa

DBGET integrated database retrieval system